<?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0"
	xmlns:content="http://purl.org/rss/1.0/modules/content/"
	xmlns:wfw="http://wellformedweb.org/CommentAPI/"
	xmlns:dc="http://purl.org/dc/elements/1.1/"
	xmlns:atom="http://www.w3.org/2005/Atom"
	xmlns:sy="http://purl.org/rss/1.0/modules/syndication/"
	xmlns:slash="http://purl.org/rss/1.0/modules/slash/"
	>

<channel>
	<title>Tech Prone - Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android &#187; wordpress</title>
	<atom:link href="http://www.techprone.com/tag/wordpress/feed/" rel="self" type="application/rss+xml" />
	<link>http://www.techprone.com</link>
	<description>Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android</description>
	<lastBuildDate>Thu, 26 Jan 2012 11:48:16 +0000</lastBuildDate>
	<language>en</language>
	<sy:updatePeriod>hourly</sy:updatePeriod>
	<sy:updateFrequency>1</sy:updateFrequency>
	<generator>http://wordpress.org/?v=3.3.1</generator>
		<item>
		<title>Artsy Editor Makes Blogging Easy and Seamless</title>
		<link>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649</link>
		<comments>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649#comments</comments>
		<pubDate>Mon, 01 Aug 2011 08:07:19 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[application]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[blogging]]></category>
		<category><![CDATA[plugin]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=4649</guid>
		<description><![CDATA[If you are a WordPress user, then this is certainly good news. Artsy Editor, a new WordPress plug-in, helps you get a distraction-free environment while blogging. This plug-in helps bloggers post their blogs easily and quickly. It promises to take just half the time when compared to posting blogs without this plug-in. Some of the [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>If you are a WordPress user, then this is certainly good news. Artsy Editor, a new WordPress plug-in, helps you get a distraction-free environment while blogging. This plug-in helps bloggers post their blogs easily and quickly. It promises to take just half the time when compared to posting blogs without this plug-in.</p>
<p><img class="aligncenter size-full wp-image-4651" title="Artsy editor" src="http://cdn.techprone.com/wp-content/uploads/2011/08/Artsy-editor1.png" alt="Artsy editor1 Artsy Editor Makes Blogging Easy and Seamless" width="560" height="318" /></p>
<p>Some of the interesting features of Artsy Editor includes:</p>
<ul>
<li>Customizing the look and feel of the user interface. Changing background colours, fonts or font sizes all made easy.</li>
<li>Formatting text is simple, selecting text automatically brings up the formatting options in a box that fade ones the text is unselected.</li>
<li>Automatic word and character count is enabled helping writers to keep track of how much is being written.</li>
<li>Images can be placed easily using drag and drop options.</li>
<li>Overlays are removed to make editing content easy.</li>
</ul>
<p>As a HTML-intensive blogger, this may not be the most effective plug-in to have. However, on the other hand if you, as a blogger, like to post long blogs with little HTML requirements, then this plug-in certainly provides a enhanced and more effective experience to blogging.</p>
<p>Needless to say, all good things come with a price. The WordPress plug-ins premium version is priced at $19. It is important to note that this is certainly a reasonable price for the kind of features it offers.</p>
<p><a href="http://artsyeditor.com/">Download Artsy Editor</a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649/feed</wfw:commentRss>
		<slash:comments>0</slash:comments>
		</item>
		<item>
		<title>How to resolve WordPress Issue &#8211; Incompatible archive: PCLZIP_ERR_BAD_FORMAT (-10)</title>
		<link>http://www.techprone.com/how-to-resolve-wordpress-issue-incompatible-archive-pclzip_err_bad_format-10/2224</link>
		<comments>http://www.techprone.com/how-to-resolve-wordpress-issue-incompatible-archive-pclzip_err_bad_format-10/2224#comments</comments>
		<pubDate>Thu, 30 Dec 2010 07:33:04 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[wordpress]]></category>
		<category><![CDATA[Tips]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=2224</guid>
		<description><![CDATA[If you encountered with the wordpress issue which hindered in upgrading the wordpress and plugins then you should look below for solutions. Sample Screenshot of &#8220;Incompatible archive: PCLZIP_ERR_BAD_FORMAT&#8221; Plugins Upgrade also failed How to resolve this Issue Just look into the storage space of your hosting, you need to increase the store space !]]></description>
			<content:encoded><![CDATA[<p></p><p>If you encountered with the wordpress issue which hindered in upgrading the wordpress and plugins then you should look below for solutions.</p>
<h3>Sample Screenshot of &#8220;Incompatible archive: PCLZIP_ERR_BAD_FORMAT&#8221; </h3>
<p><img class="aligncenter size-full wp-image-2225" title="upgrade-failed" src="http://cdn.techprone.com/wp-content/uploads/2010/12/upgrade-failed.jpg" alt="upgrade failed How to resolve Wordpress Issue   Incompatible archive: PCLZIP ERR BAD FORMAT ( 10)" width="600" /></p>
<h3>Plugins Upgrade also failed</h3>
<p><img src="http://cdn.techprone.com/wp-content/uploads/2010/12/upgrade-plugin-failed.jpg" alt="upgrade plugin failed How to resolve Wordpress Issue   Incompatible archive: PCLZIP ERR BAD FORMAT ( 10)" title="upgrade-plugin-failed" width="600" class="aligncenter size-full wp-image-2227" /></p>
<h3>How to resolve this Issue</h3>
<p>Just look into the storage space of your hosting, you need to increase the store space !</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-resolve-wordpress-issue-incompatible-archive-pclzip_err_bad_format-10/2224/feed</wfw:commentRss>
		<slash:comments>5</slash:comments>
		</item>
		<item>
		<title>How to monitor the SQL queries in WordPress Blog</title>
		<link>http://www.techprone.com/how-to-monitor-the-sql-queries-in-wordpress-blog/1616</link>
		<comments>http://www.techprone.com/how-to-monitor-the-sql-queries-in-wordpress-blog/1616#comments</comments>
		<pubDate>Mon, 31 May 2010 10:27:33 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[blogging]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[productivity]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[Web Development]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[data storage]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[performance]]></category>
		<category><![CDATA[plugins]]></category>
		<category><![CDATA[web performance]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1616</guid>
		<description><![CDATA[WordPress is most commonly use blogging platform that it used beyond the limit of blogs to the extend of CMS. Many highly traffic sites and e-commerce site use wordpress as in back end. Many times we need to monitor the server load and SQL queries running in wordpress in order to maintain the smoothness of [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>WordPress is most commonly use blogging platform that it used beyond the limit of blogs to the extend of CMS. Many highly traffic sites and e-commerce site use wordpress as in back end. Many times we need to monitor the server load and SQL queries running in wordpress in order to maintain the smoothness of websites. We know that poor and damaged performance is due to poorly designed database or SQL queries (for example, when the table does not have indices that the query can use or when the query uses unnecessary performance killers such as ORDER BY/GROUP BY).</p>
<p>If you are not familiar then i will also recommend you <a title="Permanent Link to 13 Useful WordPress SQL Queries  You Wish You Knew Earlier" rel="bookmark" href="http://www.onextrapixel.com/2010/01/30/13-useful-wordpress-sql-queries-you-wish-you-knew-earlier/">13 useful wordPress SQL queries you wish you knew earlier</a> and  <a title="Permanent Link to Top Five WordPress SQL Queries" rel="bookmark" href="http://joseph.randomnetworks.com/archives/2004/10/28/top-five-wordpress-sql-queries/">top five WordPress SQL queries.</a></p>
<h3>How to monitor the SQL queries in WordPress Blog</h3>
<p><a href="../wp-content/uploads/2010/05/sql-database.png"><img title="sql-database" src="../wp-content/uploads/2010/05/sql-database-1024x293.png" alt="sql database 1024x293 How to monitor the SQL queries in Wordpress Blog" width="630" height="293" /></a></p>
<p><a href="http://wordpress.org/extend/plugins/sqlmon/">SQL Monitor </a> is the WordPress plugin for developers, theme designers and site administrators who wants to track and resolve the quality and performance for site.</p>
<p>Note:  SQL Monitor is incompatible with plugins that install their own <code>db.php</code> into <code>wp-content</code> directory (DB Cache, DB Cache Reloaded,  probably W3 Total Cache).<a href="http://cdn.techprone.com/wp-content/uploads/2010/05/sql-database.png"><br />
</a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-monitor-the-sql-queries-in-wordpress-blog/1616/feed</wfw:commentRss>
		<slash:comments>5</slash:comments>
		</item>
		<item>
		<title>Top 10 Latest WordPress Plugins Worth Trying</title>
		<link>http://www.techprone.com/top-10-latest-wordpress-plugins-worth-trying/1604</link>
		<comments>http://www.techprone.com/top-10-latest-wordpress-plugins-worth-trying/1604#comments</comments>
		<pubDate>Wed, 06 Jan 2010 14:45:02 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[free]]></category>
		<category><![CDATA[Open Source]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[Reviews]]></category>
		<category><![CDATA[twitter]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[plugins]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1604</guid>
		<description><![CDATA[WordPress is a high-tech open source publishing platform that focuses on aesthetics, usability and high web standards. You can name this blog tool as free and priceless, which helps you work with blogging and not fight it. Apart from that there are many themes and plugins that help you plug and play with your blog/website. [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>WordPress is a high-tech open source publishing platform that focuses on aesthetics, usability and high web standards. You can name this blog tool as free and priceless, which helps you work with blogging and not fight it. Apart from that there are many themes and plugins that help you plug and play with your blog/website. At Techprone we already saw few excellent WordPress <a href="http://www.techprone.com/top-69-wordpress-plugins-for-twitter/">plugins for Twitter</a> and best <a href="http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/">plugins for adsense</a>. Now this time we will share Top 10 Latest WordPress Plugins Worth Trying that will just augment your love the giant!</p>
<p><a href="http://wordpress.org/extend/plugins/wp-synhighlight/"><strong>1. WP-SynHighlight </strong></a></p>
<p>Plugin provides syntax highlighting in posts and comments.</p>
<ul>
<li>Full GUI mode. No need to switch to code mode and back like in some other plugins</li>
<li>GUI editor with realtime syntax highligting support integrated (can be disable in settings)</li>
<li>GUI button to help with highlighting options. No need to memorize them!</li>
<li>Blog-wide default settings for code highlighting. Now you can change the look of all your posts at once!</li>
<li>Many options to customize code highlighting (almost full Geshi set)</li>
</ul>
<p style="text-align: center;"><img class="size-full wp-image-1605  aligncenter" title="WP-SynHighlight" src="http://cdn.techprone.com/wp-content/uploads/2010/01/WP-SynHighlight.jpg" alt="WP SynHighlight Top 10 Latest WordPress Plugins Worth Trying " width="550" height="316" /></p>
<p><a href=" http://wordpress.org/extend/plugins/revisionary/"><strong>2. Revisionary</strong></a></p>
<p>Have you ever wanted to allow certain users to submit changes to published content, with an editor reviewing those changes before publication? Doesn&#8217;t it seem like setting a published post/page to a future date should schedule your changes to be published on that date, instead of unpublishing it until that date? Revisionary enables moderated editing of currently published posts or pages. Contributors also gain the ability to submit revisions to their own published content. These changes, if approved by an Editor, can be published immediately or scheduled for future publication.</p>
<p>Partial Feature List</p>
<ul>
<li>Pending Revisions allow designated users to suggest changes to a currently published post/page</li>
<li>Scheduled Revisions allow you to specify future changes to published content (either via Pending Revision approval or directly by fully qualified author/editor)</li>
<li>Enchanced Revision Management Form</li>
<li>Front-end preview display of Pending / Scheduled Revisions with &#8220;Publish Now&#8221; link</li>
<li>New WordPress role, &#8220;Revisor&#8221; is a moderated Editor</li>
<li>Works with blog-wide WordPress Roles, or in conjunction with Role Scoper</li>
</ul>
<p style="text-align: center;"><img class="size-full wp-image-1606  aligncenter" title="Revisionary" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Revisionary.png" alt="Revisionary Top 10 Latest WordPress Plugins Worth Trying " width="550" height="328" /></p>
<p><a href="http://wordpress.org/extend/plugins/web-worth-blog-value-calculator/"><strong>3. Web Worth Blog Value Calculator</strong></a></p>
<p>Web Worth Blog Value Calculator is a plug-in that gives you a nice tidy widget to display your blog&#8217;s current estimated value in dollars. This information is displayed to you and your visitors to demonstrate just how much hard work you have put into your blog &#8211; Why not show this cool statistic off? This widget is dynamically updated when the sites value is updated at Web Worth. The site must be valued at Web Worth before it will show a value in dollars otherwise you will just see a VALUATE NOW warning.</p>
<p style="text-align: center;"><img class="size-full wp-image-1607  aligncenter" title="Blog Value Calculator" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Blog-Value-Calculator.png" alt="Blog Value Calculator Top 10 Latest WordPress Plugins Worth Trying " width="550" height="340" /></p>
<p><a href="http://wordpress.org/extend/plugins/all-in-one-webmaster/"><strong>4. All in One Webmaster </strong></a></p>
<p>If you are a webmaster then you probably know Google Webmaster Tool. Both Yahoo and Bing have their own versions called Yahoo SiteExplorer and Bing Webmaster Central. With them you can check how your site is indexed (Webmaster Tool), get detailed statistics (Analytics Tool), earn money (Google AdSense) and more.</p>
<p>This plugin allows you to easily integrate them with your blog. It has option to add Google, Bing, Yahoo&#8217;s Webmaster and Analytics code. Single click sitemap submission to Google, Bing, Yahoo and Ask. In addition to that it has option to add tracking code for Clicky, 103Bees analytics!! Site-Verification-Option, Google XML sitemap submission. There are more to come in next releases. Stay tuned.</p>
<p>Features</p>
<ul>
<li>NEW: Updates the Asynchronous Tracking snippet to the latest version provided by Google</li>
<li>getClicky.com analytics option added</li>
<li>103Bees.com analytics option added</li>
<li>XML Sitemap submission to Google.com, Yahoo.com and Ask.com</li>
<li>Warning/Success/Failure messages added</li>
<li>Option to add Google, Bing, Yahoo Webmaster Meta-Tag</li>
<li>Option to add Google Analytics code</li>
</ul>
<p style="text-align: center;"><img class="size-full wp-image-1608  aligncenter" title="All in One Webmaster" src="http://cdn.techprone.com/wp-content/uploads/2010/01/All-in-One-Webmaster.jpg" alt="All in One Webmaster Top 10 Latest WordPress Plugins Worth Trying " width="550" height="606" /></p>
<p><a href="http://wordpress.org/extend/plugins/login-with-ajax/"><strong>5. Login With Ajax</strong></a></p>
<p>Login With Ajax is for sites that need user logins and would like to avoid the normal wordpress login, this plugin adds the capability of placing a login widget in the sidebar with smooth AJAX login effects.</p>
<p>Some of the features:</p>
<ul>
<li>Login without refreshing your screen using AJAX calls.</li>
<li>Password retrieval now available within the widget.</li>
<li>Compatible with WordPress, WordPress MU and BuddyPress.</li>
<li>Will work with forced SSL logins.</li>
<li>Customizable, upgrade-safe widgets.</li>
<li>Redirect users to custom URLs on Login and Logout</li>
<li>Redirect users with different roles to custom URLs</li>
<li>shortcode and template tags available</li>
<li>Fallback mechanism, will still work on javascript-disabled browsers</li>
<li>Widget specific option to show link to profile page</li>
</ul>
<p style="text-align: center;"><img class="size-full wp-image-1609  aligncenter" title="Login With Ajax" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Login-With-Ajax.jpg" alt="Login With Ajax Top 10 Latest WordPress Plugins Worth Trying " width="550" height="300" /></p>
<p><a href="http://wordpress.org/extend/plugins/buddypress-group-documents/"><strong>6. Group Document </strong></a></p>
<p>Group Documents creates a page within each BuddyPress group to upload and store documents. Documents can be edited and deleted either by the document owner or by the group administrator. Document activity is logged in the main activity stream, and is also tied to the user and group activity streams. The site administrator can set filters on file extensions, and users and moderators can receive email notifications at their option. There is also a &#8220;Recent Uploads&#8221; widget than can be used to show any number of recently uploaded documents.</p>
<p style="text-align: center;"><img class="size-full wp-image-1610  aligncenter" title="Group Document" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Group-Document.gif" alt="Group Document Top 10 Latest WordPress Plugins Worth Trying " width="550" height="296" /></p>
<p><a href=" http://wordpress.org/extend/plugins/wp-content-slideshow/"><strong>7. WP Content Slideshow</strong></a></p>
<p>WP Content Slideshow shows up to 5 Posts in a very nice and powerfull Javascript Slideshow. On the left side of the Slideshow it displays a Image for every Post. On the right side, there are all the Titles (and a small description under the Title) of the Posts. The Slideshow highlights the active Post and repeats automatically after getting to the 5th Post. You have a powerfull Administration Area to adjust the Category, the number of Posts, the width and height, and many colours for the Slideshow!</p>
<ul>
<li>Titles and small description</li>
<li>Navigation possibility (when hitting a Title the Image appears)</li>
<li>Image for every different Post</li>
<li>Powerfull Administration for Posts and Styles of the Slideshow</li>
<li>Javascript Effects between different Posts</li>
</ul>
<p style="text-align: center;"><img class="size-full wp-image-1611  aligncenter" title="WP Content Slideshow" src="http://cdn.techprone.com/wp-content/uploads/2010/01/WP-Content-Slideshow.png" alt="WP Content Slideshow Top 10 Latest WordPress Plugins Worth Trying " width="550" height="347" /></p>
<p><a href=" http://wordpress.org/extend/plugins/online-leaf/"><strong>8. Online Leaf</strong></a></p>
<p>Online Leaf is a project started to help the Internet become greener, and through this plugin, it has been made easy for WordPress users to get a Green Website as well. Online Leaf is a project started to help the Internet become greener, and through this plugin, it has been made easy for WordPress users to get a Green Website as well.</p>
<p>Online Leaf aims to reduce the overall CO2 emissions from displaying websites, without any loss of visitor experience. You can still use visual effects, animations and heavy graphics to improve your website&#8217;s overall quality, since the standby engine does not conflict with any of those (as it is only activated when your visitors are inactive). The only change is that your blog will be a Green Website and help in making the web a much greener place to surf.</p>
<p style="text-align: center;"><img class="size-full wp-image-1612  aligncenter" title="Online Leaf" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Online-Leaf.jpg" alt="Online Leaf Top 10 Latest WordPress Plugins Worth Trying " width="550" height="196" /></p>
<p><a href=" http://wordpress.org/extend/plugins/multiple-content-blocks/"><strong>9. Multiple Content Blocks</strong></a></p>
<p>With this plug-in, you can use more than one content &#8220;block&#8221; on a template. You only have to insert one tag inside the template, so its easy to use. When you make a WordPress template, you can show the content of the current page by using the code the_content();, but when you have (for example) several columns, you cannot split these in different content &#8220;blocks&#8221;.</p>
<p style="text-align: center;"><img class="size-full wp-image-1613  aligncenter" title="Multiple Content Blocks" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Multiple-Content-Blocks.jpg" alt="Multiple Content Blocks Top 10 Latest WordPress Plugins Worth Trying " width="550" height="252" /></p>
<p><a href=" http://wordpress.org/extend/plugins/short-url-plugin/"><strong>10. Short URL Plugin</strong></a><strong> </strong></p>
<p>Short URL allows you to create shorter URL&#8217;s and keeps track of how many times a link has been clicked. It&#8217;s useful for managing downloads, keeping track of outbound links and for masking URL&#8217;s. Clicking the Clear All Clicks button will reset the count for each entry. Visit the plugin page for more information about this plugin.</p>
<p>Version 2.7.1 includes pagination of links, easier setup of htaccess (permalinks) and allows admins to pass variables to their redirects. It also allows customisation of the permalink so you&#8217;re no longer limited to /u/23.</p>
<p>Modify u.php if you&#8217;d like a custom message when a redirect is not found.</p>
<p style="text-align: center;"><img class="size-full wp-image-1614  aligncenter" title="Short URL Plugin" src="http://cdn.techprone.com/wp-content/uploads/2010/01/Short-URL-Plugin.png" alt="Short URL Plugin Top 10 Latest WordPress Plugins Worth Trying " width="550" height="449" /></p>
<p>I hope this article was useful to you and feel free to share your experience working with above wordpress plugins!</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/top-10-latest-wordpress-plugins-worth-trying/1604/feed</wfw:commentRss>
		<slash:comments>13</slash:comments>
		</item>
		<item>
		<title>How to manage series of posts in wordpress blogs</title>
		<link>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510</link>
		<comments>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510#comments</comments>
		<pubDate>Wed, 09 Sep 2009 22:53:17 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[how to]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[plugin]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1510</guid>
		<description><![CDATA[This post is dedicated for those who are into writing any tutorials or posts on particular categories and wants to drag all the posts into a consecutive series of articles. Organize Series WordPress Plugin is the solutions to all your queries. It helps in managing and organizing the series of posts on the basis of  [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>This post is dedicated for those who are into writing any tutorials or posts on particular categories and wants to drag all the posts into a consecutive series of articles.</p>
<p><a href="http://wordpress.org/extend/plugins/organize-series/">Organize Series WordPress Plugin</a> is the solutions to all your queries. It helps in managing and organizing the series of posts on the basis of  <a href="http://codex.wordpress.org/WordPress_Taxonomy">taxonomy</a>.</p>
<h4>Screen Shot of Organize Series Plugin Options</h4>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/09/OrganizeSeriesPluginOptions.png"><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="Organize Series Plugin Options" src="http://cdn.techprone.com/wp-content/uploads/2009/09/OrganizeSeriesPluginOptions_thumb.png" border="0" alt="OrganizeSeriesPluginOptions thumb How to manage series of posts in wordpress blogs" width="574" height="2060" /></a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510/feed</wfw:commentRss>
		<slash:comments>3</slash:comments>
		</item>
		<item>
		<title>Top 69 WordPress plugins for Twitter</title>
		<link>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469</link>
		<comments>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469#comments</comments>
		<pubDate>Thu, 13 Aug 2009 08:26:54 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Plugin]]></category>
		<category><![CDATA[Tools]]></category>
		<category><![CDATA[twitter]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[social media]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1469</guid>
		<description><![CDATA[Managing the twitter together with WordPress blogs is an efficient way to land into social media. You can manage your WordPress blogs together with Twitter upto any extent with the helps of below listed WordPress plugins. Topical Tweets Topical Tweets enables the display of Twitter Updates in your blog for a specific query Tweetable Integrate [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Managing the twitter together with WordPress blogs is an efficient way to land into social media. You can manage your WordPress blogs together with Twitter upto any extent with the helps of below listed WordPress plugins. <img style="border-bottom: 0px; border-left: 0px; display: block; float: none; margin-left: auto; border-top: 0px; margin-right: auto; border-right: 0px" title="69-twitter-plugin" src="http://cdn.techprone.com/wp-content/uploads/2009/08/69twitterplugin.gif" border="0" alt="69twitterplugin Top 69 Wordpress plugins for Twitter" width="567" height="203" /></p>
<ol>
<li><a href="http://wordpress.org/extend/plugins/topical-tweets/">Topical Tweets</a> Topical Tweets enables the display of Twitter Updates in your blog for a specific query</li>
<li><a href="http://wordpress.org/extend/plugins/tweetable/">Tweetable</a> Integrate Twitter with your WordPress blog. Automatically tweet new posts, display your latest tweet in your sidebar, etc.</li>
<li><a href="http://wordpress.org/extend/plugins/advanced-twitter-widget/">Advanced Twitter Widget</a> Widget that will enable visitors to give you/the site a virtual beer by clicking on the widget.</li>
<li><a href="http://wordpress.org/extend/plugins/gigya-socialize-for-wordpress/">Gigya Socialize &#8211; Increase Registration and Engagement using Facebook Connect, Twitter and OpenID</a></li>
<p>Increase your site registration and Engagement using Facebook Connect, MySpaceID, Twitter and OpenID.</p>
<li><a href="http://wordpress.org/extend/plugins/tweelow/">Tweelow Plugin</a> Simple plugin that displays count of your twitter followers.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-liveblog/">Twitter LiveBlog</a></li>
<p>Twitter LiveBlog is a plugin that lets you liveblog on your WordPress blog using Twitter.</p>
<li><a href="http://wordpress.org/extend/plugins/twimp-wp/">Twimp-wp</a></li>
<p>Publish blog posts to multiple twitter accounts.</p>
<li><a href="http://wordpress.org/extend/plugins/twitconnect/">Twit Connect</a></li>
<p>Integrate Twitter and WordPress. Provides single-signon and avatars. Changes in Version 1.11 &#8211; Bug fix for missing &#8216;=&#8217; in login code.</p>
<li><a href="http://wordpress.org/extend/plugins/pretty-link/">Pretty Link</a> Shrink, track and share any URL on the Internet from your WordPress website. Create short links suitable for Twitter using your own domain name!</li>
<li><a href="http://wordpress.org/extend/plugins/db-twtpoll/">dB Twtpoll</a> This plugins adds a shortcode for embedding polls from Twtpoll really easy.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-real-time-search-scrolling/">Twitter real time search scrolling</a> This plug-in will scroll the most recent twittered contents based on the entered search word. Enter search word and see the live content in side bar.</li>
<li><a href="http://wordpress.org/extend/plugins/wordpress-dashboard-twitter/">WordPress Dashboard Twitter</a> The most creative name **WordPress Dashboard Twitter** in fact represents a Dashboard Widget for WordPress, that turns your Dashboard into a Twitter</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-news-feed/">Twitter News Feed</a> Collects Tweets based on specific Twitter usernames and hashtags and then adds them as post</li>
<li><a href="http://wordpress.org/extend/plugins/buzzom-badge-plugin/">Buzzom Badge</a> This plugin let&#8217;s you display a small badge which shows your Buzzom profile.</li>
<li><a href="http://wordpress.org/extend/plugins/wp-twittersearch/">WP-TwitterSearch</a> Displays the latest results based on a twitter search. Options include setting multiple search terms and limiting tweets shown.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tools-google-analytics-tagging/">Twitter Tools &#8211; Google Analytics Tagger</a> Tag all your URL&#8217;s posted to twitter with Google Analytics tags using Twitter Tools</li>
<li><a href="http://wordpress.org/extend/plugins/wp-to-twitter/">WP to Twitter</a> Posts a Twitter status update when you update your WordPress blog or post to your blogroll, using the Cligs URL shortening service.</li>
<li><a href="http://wordpress.org/extend/plugins/twire/">Twire</a> This plugin will bring Twitter functionality to your buddypress installation. You must have 2 things: 1. WordPress MU, 2. Buddy Press</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-bubble/">Twitter Bubble</a> A sidebar widget showing the latest twitter update in a nice talk bubble, suitable for wide sidebars.</li>
<li><a href="http://wordpress.org/extend/plugins/lifestream/">Lifestream</a> Streams your activity from over 50 different sources to your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/easy-retweet/">Easy Retweet</a> Adds a Retweet button to your WordPress posts</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-blog/">Twitter Blog</a> Tweets your post, then captures tweets replying to that tweet and converts them to comments.</li>
<li><a href="http://wordpress.org/extend/plugins/feed2tweet/">Feed2tweet</a> Feed2tweet plugins allows you to publish your new posts to your twitter account.</li>
<li><a href="http://wordpress.org/extend/plugins/zipli-retweet/">Zipli-Retweet</a> Adds a retweet button to all WordPress posts in your blog and update your twitter account with post from your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-friendly-links/">Twitter Friendly Links</a> Your very own TinyURL within your OWN domain! If you DO promote your blog posts in Twitter, then you MUST make your links look cool!</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-followers/">Twitter Followers</a> Display your Twitter followers or people you are following in your sidebar.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-friends-widget/">Twitter Friends Widget</a></li>
<p>Displays your Twitter friends with their profile images in the sidebar.</p>
<li><a href="http://wordpress.org/extend/plugins/tweetmeme/">TweetMeme Button</a></li>
<p>Adds the TweetMeme button into your posts and RSS feed.</p>
<li><a href="http://wordpress.org/extend/plugins/twitpic/">TwitPic</a></li>
<p>Displays your latest pictures from TwitPic in the sidebar of your blog. The plugin is widget ready and comes with many configuration options!</p>
<li><a href="http://wordpress.org/extend/plugins/make-me-social-automatically-submit-posts-to-delicious-twitter-tumblr-diigo/">Make Me Social</a></li>
<p>The &#8220;Make Me Social&#8221; wordpress plugin send each new post you make to the most famous social services.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-publisher/">Twitter Publisher</a> Share a new blog post on Twitter using awe.sm or bit.ly url shorteners.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tools/">Twitter Tools</a> Twitter Tools is a plugin that creates a complete integration between your WordPress blog and your Twitter account.</li>
<li><a href="http://wordpress.org/extend/plugins/lockablog/">Lock a Blog</a></li>
<p>This plugin allows you block content wordpress post for underage readers.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-links-plus/">Twitter Links Plus+</a></li>
<p>Checks Twitter usernames mentioned in the content and in the comments (eg. @tquizzle) with the Twitter service to see if that user is indeed a Twitter</p>
<li><a href="http://wordpress.org/extend/plugins/twitpost/">Twitpost</a></li>
<p>A plugin that posts a short blurb on your Twitter page linking to a post you&#8217;ve recently published.</p>
<li><a href="http://wordpress.org/extend/plugins/comenta-wp/">Comenta WP</a></li>
<p>Publish all your comments directly to a twitter account. You can customize the message published.</p>
<li><a href="http://wordpress.org/extend/plugins/capture-the-conversation/">Capture the Conversation</a></li>
<p>What are people saying about your post, right now?</p>
<li><a href="http://wordpress.org/extend/plugins/twittertowire/">Twitter To Wire</a></li>
<p>This plugin will allow your twits to be automatically added to your Buddy Press wire. You must have 2 things: 1. WordPress MU, 2. Buddy Press</p>
<li><a href="http://wordpress.org/extend/plugins/tweetscribe/">TweetScribe</a></li>
<p>TweetScribe plugin connects your WordPress blog with TweetScribe.me</p>
<li><a href="http://wordpress.org/extend/plugins/pingpressfm/">PingPressFM</a></li>
<p>Allows you to spread your blog to 30+ social networks via ping.fm. Now with support for scheduled posts and custom triggers.</p>
<li><a href="http://wordpress.org/extend/plugins/wickett-twitter-widget/">Wickett Twitter Widget</a>Display tweets from a Twitter account in the sidebar of your blog. As seen on WordPress.com.</li>
<li><a href="http://wordpress.org/extend/plugins/shortcode-shorturl/">Short URL Generator</a></li>
<p>This plugin automatically generates a Short URL for your article. You can choose your favorite provider and get multiple options.</p>
<li><a href="http://wordpress.org/extend/plugins/commentwitter/">Commentwitter</a> Gives commenters the option of Tweeting their comment with a link to your post.</li>
<li><a href="http://wordpress.org/extend/plugins/tweetly-updater/">Tweetly Updater</a></li>
<p>This plugin sends Twitter updates on new or edited posts, uses bit.ly.</p>
<li><a href="http://wordpress.org/extend/plugins/twittersearch/">TwitterSearch</a></li>
<p>TwitterSearch allows users to keep track of twitter search terms from within their wordpress dashboard.</p>
<li><a href="http://wordpress.org/extend/plugins/tracked-tweets/">Tracked Tweets</a></li>
<p>Posts are added to your twitter account. Tweet can be formatted. URL&#8217;s are shortened using Tinyurl or bit.ly, and Google Analytics tracking is added.</p>
<li><a href="http://wordpress.org/extend/plugins/thread-twitter/">Thread Twitter</a></li>
<p>Thread Twitter fetch your tweets and display them in thread style.</p>
<li><a href="http://wordpress.org/extend/plugins/tweet-cloud/">Tweet Cloud</a></li>
<p>Cloud of popular words and phrases from a user&#8217;s Twitter profile.</p>
<li><a href="http://wordpress.org/extend/plugins/rf-twitterpost/">RF Twitter Post</a> A simple plugin that will post to twitter whenever you add a new post to your wordpress blog.</li>
<li><a href="http://wordpress.org/extend/plugins/simple-twitter-link/">Simple Twitter Link</a></li>
<p>Simple Twitter Link displays a link allowing Twitter users to update their status with a link back to your post or page.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-posts/">TwitterPosts</a></li>
<p>This WordPress plugin automatically sends new posts of your blog to twitter as soon as they get published.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-digest/">Twitter Digest</a></li>
<p>Creates a daily post containing tweets from a twitter account.</p>
<li><a href="http://wordpress.org/extend/plugins/social-media-manager/">Social Media Manager</a></li>
<p>Manage &amp; monitor your social media brand. Facebook, twitter, digg, youtube &amp; tumblr. Post to multiple twitter accounts easy.</p>
<li><a href="http://wordpress.org/extend/plugins/wp-quote-tweets/">WP Quote Tweets</a></li>
<p>Allows authors to quote Twitter updates in posts or pages using a simple shortcode. [quotetweet tweetid=123456789].</p>
<li><a href="http://wordpress.org/extend/plugins/fresh-from-friendfeed-and-twitter/">Fresh From FriendFeed and Twitter</a> Keeps your blog always fresh by regularly adding your latest and greatest content from FriendFeed or Twitter. No external passwords required!</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-profile-field/">Twitter Profile Field</a> Adds an additional field to the user profile page where they can enter their Twitter username.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tracker/">Twitter Tracker</a></li>
<p>Tracks Twitter search results or a Twitter hashtag in a sidebar widgets.</p>
<li><a href="http://wordpress.org/extend/plugins/social-links-sidebar/">Social Links Sidebar</a></li>
<p>Social Links Sidebar is a sidebar widget that displays icon links to your profile pages on other social networking sites.</p>
<li><a href="http://wordpress.org/extend/plugins/itwitter/">iTwitter</a> Twitter plugin for WordPress. A useful plugin for those who uses Twitter.</li>
<li><a href="http://wordpress.org/extend/plugins/tweet-tweet/">Tweet Tweet</a> Archive your Twitter conversions in your database, and use your free web texts to receive sms notifications.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-keywords/">Twitter Keywords</a></li>
<p>Add tweets about a certain word, in certain language and from a specific user on your sidebar</p>
<li><a href="http://wordpress.org/extend/plugins/shorten2ping/">Shorten2Ping</a></li>
<p>Sends status updates to Ping.fm or Twitter everytime you publish a post, using Bit.ly or Tr.im for the permalinks.</p>
<li><a href="http://wordpress.org/extend/plugins/twittercounter/">TwitterCounter</a></li>
<p>Integrate TwitterCounter.com badges on your blog to display the number of followers you have on Twitter</p>
<li><a href="http://wordpress.org/extend/plugins/twittley-button/">Twittley button</a></li>
<p>This plugin will install the Twittley button for each of your blog posts in both the content of your posts and the RSS feed.</p>
<li><a href="http://wordpress.org/extend/plugins/twittrup/">Twittrup</a></li>
<p>Updates Twitter when you create a new blog post utilizing an shortener service of your choice.</p>
<li><a href="http://wordpress.org/extend/plugins/tweet-blender/">Tweet Blender</a></li>
<p>Adds Twitter sidebar widget and creates an archive page. Blends Twitter tweets for multiple screen names, hashtags and/or keywords into a single stream.</p>
<li><a href="http://wordpress.org/extend/plugins/backtype-connect/">BackType Connect</a> The BackType Connect WordPress plugin lets you show related conversations (from Twitter, Digg, FriendFeed &amp; more) inline with your own comments.</li>
<li><a href="http://wordpress.org/extend/plugins/wp-bar/">The WordPress Bar</a> Seen the DiggBar on Digg.com? Add a similar feature to your WordPress blog by creating a navigation bar for all external links outside of blog.</li>
<li><a href="http://wordpress.org/extend/plugins/yourls-wordpress-to-twitter/">YOURLS: WordPress to Twitter</a></li>
<p>Use YOURLS (a free GPL URL shortener service) or another public service (tinyURL&#8230;) to create short URL of your posts and tweet them.</ol>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469/feed</wfw:commentRss>
		<slash:comments>9</slash:comments>
		</item>
		<item>
		<title>WP-Super-Cache comes with new check list of Accepted Filenames &amp; Rejected URIs</title>
		<link>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409</link>
		<comments>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409#comments</comments>
		<pubDate>Sun, 02 Aug 2009 17:36:34 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Plugin]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[web]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1409</guid>
		<description><![CDATA[I assumed that you know about one of the most brilliant WordPress Plugin, WP Super Cache, used to enhance the website / blog performance by increasing its loading time. If you doesn’t hear about it then on a simple note its functionality can be described as This plugin generates static html files from your dynamic [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>I assumed that you know about one of the most brilliant WordPress Plugin, <a href="http://wordpress.org/extend/plugins/wp-super-cache/">WP Super Cache</a>, used to enhance the website / blog performance by increasing its loading time. If you doesn’t hear about it then on a simple note its functionality can be described as</p>
<blockquote><p>This plugin generates static html files from your dynamic WordPress blog. After a html file is generated your webserver will serve that file instead of processing the comparatively heavier and more expensive WordPress PHP scripts.</p>
<p>The static html files will be served to the vast majority of your users, but because a user&#8217;s details are displayed in the comment form after they leave a comment those requests are handled by PHP. Static files are served to:</p>
<ol>
<li>Users who are not logged in.</li>
<li>Users who have not left a comment on your blog.</li>
<li>Or users who have not viewed a password protected post.</li>
</ol>
</blockquote>
<p>Thanks to <a href="http://twitter.com/Donncha">Donncha</a> for creating this awesome plugin. Now the what’s the point of this blog post? This blog post aims toward the recent update in the <a href="http://wordpress.org/extend/plugins/wp-super-cache/">WP Super Cache</a> where it comes with new check list of <strong>Accepted Filenames &amp; Rejected URIs</strong>. Initially we used to defined the manual file names with php extensions for the rejection of the <a class="zem_slink" title="Cache" rel="wikipedia" href="http://en.wikipedia.org/wiki/Cache">caching</a> but now it work even beyond that.</p>
<pre class="csharpcode">wp-.*\.php
index\.php</pre>
<p><!--</p>
<p>.csharpcode, .csharpcode pre<br />
{<br />
font-size: small;<br />
color: black;<br />
font-family: consolas, "Courier New", courier, monospace;<br />
background-color: #ffffff;<br />
/*white-space: pre;*/<br />
}<br />
.csharpcode pre { margin: 0em; }<br />
.csharpcode .rem { color: #008000; }<br />
.csharpcode .kwrd { color: #0000ff; }<br />
.csharpcode .str { color: #006080; }<br />
.csharpcode .op { color: #0000c0; }<br />
.csharpcode .preproc { color: #cc6633; }<br />
.csharpcode .asp { background-color: #ffff00; }<br />
.csharpcode .html { color: #800000; }<br />
.csharpcode .attr { color: #ff0000; }<br />
.csharpcode .alt<br />
{<br />
background-color: #f4f4f4;<br />
width: 100%;<br />
margin: 0em;<br />
}<br />
.csharpcode .lnum { color: #606060; } --></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="wp-super-cache" src="http://cdn.techprone.com/wp-content/uploads/2009/08/wpsupercache.png" border="0" alt="wpsupercache WP Super Cache comes with new check list of Accepted Filenames &amp; Rejected URIs" width="519" height="342" /></p>
<p>Now the check list comes with the options of <a href="http://codex.wordpress.org/Conditional_Tags">Conditional Tags</a> (Tags used to define the conditions of the contents in the templates). The main changes in the recent 0.9.6.1 updates are listed below:</p>
<blockquote><p>1. Ability to move &#8220;not logged in&#8221; message init below check for POST.</p>
<p>2. Options to add is_admin() check so plugin definitely can&#8217;t cache the backend.</p>
<p>3. Options to add &#8220;do not cache&#8221; page type to admin page.</p></blockquote>
<p>What is the benefits ?</p>
<p>Now the page which changes most like your home page , front page loads the recent updates and changes with any hassle of clearing the cache.</p>
<div class="zemanta-related">
<h6 class="zemanta-related-title" style="font-size: 1em">Related articles that inforce the use of WP-Super-Cache and recognised by other:</h6>
<ul class="zemanta-article-ul">
<li class="zemanta-article-ul-li"><a href="http://www.blogherald.com/2009/07/30/wp-super-cache-gets-bumped-to-0-9-6-1/">WP Super Cache Gets Bumped to 0.9.6.1</a> (blogherald.com)</li>
<li class="zemanta-article-ul-li"><a href="http://r.zemanta.com/?u=http%3A//www.wizardstower.co.uk/wordpress/2009/04/06/db-cache-plugin-for-wordpress/&amp;a=4522171&amp;rid=2b7e50b4-c2ca-4da5-bb79-b2e6b8ab1092&amp;e=fa1c1b0be028a9e0c4a54c85c7e9abc9">DB Cache plugin for WordPress</a> (wizardstower.co.uk)</li>
<li class="zemanta-article-ul-li"><a href="http://www.noupe.com/wordpress/13-great-wordpress-speed-tips-tricks-for-max-performance.html">13 Great WordPress Speed Tips &amp; Tricks for MAX Performance</a> (noupe.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.dbms2.com/2009/07/28/oops-i-didnt-have-caching-turned-on/">Oops, I didn&#8217;t have caching turned on</a> (dbms2.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.smtusa.com/blog/posts/Top-Five-Wordpress-Plugins.html">Top Five WordPress Plugins</a> (smtusa.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.blogherald.com/2009/04/27/5-wordpress-plugins-i-never-blog-without/">5 WordPress Plugins I Never Blog Without</a> (blogherald.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.newofferings.com/wordpress/12-wordpress-plugins-that-you-must-have/">12 WordPress Plugins That You Must Have</a> (newofferings.com)</li>
</ul>
</div>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>How to implement Facebook Connect with your WordPress Blog</title>
		<link>http://www.techprone.com/how-to-facebook-connect-wordpress-blog/1330</link>
		<comments>http://www.techprone.com/how-to-facebook-connect-wordpress-blog/1330#comments</comments>
		<pubDate>Sat, 18 Jul 2009 14:42:40 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[how to]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[tutorial]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[comments]]></category>
		<category><![CDATA[facebook]]></category>
		<category><![CDATA[facebook connect]]></category>
		<category><![CDATA[theme]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1330</guid>
		<description><![CDATA[Recently Facebook launches the Facebook Connect APIs which provides the great functionalities like single sign-on, avatars, and News Feed publication of comments within your WordPress blogs. It is very simple to implement Facebook Connect with your WordPress blogs and here are the few simple steps to achieve it successfully. Step 1 Download / Install and [...]]]></description>
			<content:encoded><![CDATA[<p></p><p><img class="alignright" title="facebook-connect" src="../wp-content/uploads/2009/07/facebook-connect.png" alt="facebook connect How to implement Facebook Connect with your Wordpress Blog" width="200" height="150" />Recently Facebook launches the <a href="http://wiki.developers.facebook.com/index.php/Facebook_Connect">Facebook Connect</a> APIs which provides the great functionalities like single sign-on, avatars, and News Feed publication of comments within your WordPress blogs. It is very simple to implement Facebook Connect with your WordPress blogs and here are the few simple steps to achieve it successfully.</p>
<h3>Step 1</h3>
<p>Download / Install and activate the best Facebook Connect plugin <strong><a href="http://wordpress.org/extend/plugins/wp-facebookconnect/">WP-FacebookConnect</a> </strong>for WordPress. You can also Search <em>WP-FacebookConnect </em>from<em> </em><strong>Plugins&gt;Add New</strong> of your WordPress dashboard.<img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="add-new-plugin" src="http://cdn.techprone.com/wp-content/uploads/2009/07/addnewplugin.png" border="0" alt="addnewplugin How to implement Facebook Connect with your Wordpress Blog" width="582" height="217" /></p>
<h3>Step2</h3>
<p>Implement the following changes in your comment.php files located under your current WordPress theme folder.</p>
<p>Open the file comment.php file and locate the following code:</p>
<div class="csharpcode">
<pre class="alt">&lt;?php if ( $user_ID ) : ?&gt;</pre>
<pre>...</pre>
<pre class="alt">...</pre>
<p>Add this php-function above your code, this will call the Facebook Connect buttons besides your comments fields. Here is the code to include :</p></div>
<pre class="csharpcode">&lt;div style="float:right;"&gt;
&lt;?php do_action('fbc_display_login_button') ?&gt;
&lt;/div&gt;</pre>
<p><!--.csharpcode, .csharpcode pre { 	font-size: small; 	color: black; 	font-family: consolas, "Courier New", courier, monospace; 	background-color: #ffffff; 	/*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt  { 	background-color: #f4f4f4; 	width: 100%; 	margin: 0em; } .csharpcode .lnum { color: #606060; } --></p>
<h3>Step3</h3>
<p>Configure your Facebook Connect Plugin Options and enter the <strong>API Key</strong> and <strong>Secret Key </strong>generated from <a href="http://www.facebook.com/developers/createapp.php?version=new">Facebook application registration page</a><a href="http://cdn.techprone.com/wp-content/uploads/2009/07/pluginoption.png"><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="plugin-option" src="http://cdn.techprone.com/wp-content/uploads/2009/07/pluginoption_thumb.png" border="0" alt="pluginoption thumb How to implement Facebook Connect with your Wordpress Blog" width="581" height="504" /></a></p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="facebook-api" src="http://cdn.techprone.com/wp-content/uploads/2009/07/facebookapi.png" border="0" alt="facebookapi How to implement Facebook Connect with your Wordpress Blog" width="582" height="116" /></p>
<h3>The final button will look like below</h3>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="comment-look" src="http://cdn.techprone.com/wp-content/uploads/2009/07/commentlook.png" border="0" alt="commentlook How to implement Facebook Connect with your Wordpress Blog" width="579" height="400" /></p>
<h3>How this plugin works?</h3>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="facebook-login" src="http://cdn.techprone.com/wp-content/uploads/2009/07/facebooklogin.png" border="0" alt="facebooklogin How to implement Facebook Connect with your Wordpress Blog" width="579" height="570" /></p>
<p>Whenever a user wants to comments he need not any logins and just require a Facebook authentication. This works on the principle of WordPress login cookie which is set by the plugin as soon as the WordPress and Facebook accounts are linked and the Facebook user ID is verified. The best thing about the Facebook Connect is that users need not any registrations or require any forms filling as all the user with verification will be automatically logged into the blog.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-facebook-connect-wordpress-blog/1330/feed</wfw:commentRss>
		<slash:comments>23</slash:comments>
		</item>
		<item>
		<title>How to know about the technology used by top blog to power the blog</title>
		<link>http://www.techprone.com/how-to-know-about-the-technology-used-by-top-blog-to-power-the-blog/1319</link>
		<comments>http://www.techprone.com/how-to-know-about-the-technology-used-by-top-blog-to-power-the-blog/1319#comments</comments>
		<pubDate>Sun, 12 Jul 2009 18:22:43 +0000</pubDate>
		<dc:creator>himanshu</dc:creator>
				<category><![CDATA[blogging]]></category>
		<category><![CDATA[blogging platform]]></category>
		<category><![CDATA[know about website]]></category>
		<category><![CDATA[sitonomy]]></category>
		<category><![CDATA[website information]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1319</guid>
		<description><![CDATA[Do you want to know about the tricks use by famous bloggers on their blog to make it powerful. There is a service known as Sitonomy from the help of which you can know more about different blogs. According to Sitonomy “Sitonomy is a free service that allows developers and designers to find out which [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Do you want to know about the tricks use by famous bloggers on their blog to make it powerful. There is a service known as Sitonomy from the help of which you can know more about different blogs.</p>
<p>According to Sitonomy “<em>Sitonomy is a free service that allows developers and designers to find out which technologies are used in a specific blog/site. Together with the provided statistic information of popular technologies, this service makes it easier to decide what technologies are suitable to your own site. List of top alternatives are provided for the following categories: </em><em>affiliate networks</em><em>, </em><em>advertising networks</em><em>, </em><em>analytical tools</em><em> and more</em>.”</p>
<p>Here is a snapshor of a result of Problogger.net which is the most famous website for bloggers. This site is maintained by Darren Rowse.</p>
<p>You can easily see that he use Chitika Advertising service to monetize his blog. Also he use Google admanager to manage Google ads.</p>
<p>This service also told about which blogging platform is used by the blog. Also it gives information about server IP, programming language, stats tools, Javascript libraries, and feed subscription.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/07/sitonomy.jpg"><img style="border-bottom: 0px; border-left: 0px; display: inline; margin-left: 0px; border-top: 0px; margin-right: 0px; border-right: 0px" title="sitonomy" src="http://cdn.techprone.com/wp-content/uploads/2009/07/sitonomy_thumb.jpg" border="0" alt="sitonomy thumb How to know about the technology used by top blog to power the blog" width="554" height="1006" align="left" /></a></p>
<p>Overall, this service is very useful to know about bigger players, also you can know about the top blog of the world like <a href="http://techcrunch.com">Techcrunch</a> or <a href="http://mashable.com">Mashable</a>, its surprising to see that both are using WordPress as a blogging platform.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-know-about-the-technology-used-by-top-blog-to-power-the-blog/1319/feed</wfw:commentRss>
		<slash:comments>3</slash:comments>
		</item>
		<item>
		<title>How to choose the best images for the blog posts using Flickr</title>
		<link>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276</link>
		<comments>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276#comments</comments>
		<pubDate>Mon, 06 Jul 2009 10:38:43 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Flickr]]></category>
		<category><![CDATA[free]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[blog]]></category>
		<category><![CDATA[bloggers]]></category>
		<category><![CDATA[blogging]]></category>
		<category><![CDATA[image editing]]></category>
		<category><![CDATA[image flickr]]></category>
		<category><![CDATA[Images]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1276</guid>
		<description><![CDATA[As we all know that “content is the king” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only. Power of Images: If i described in more [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>As we all know that “<strong><em>content is the king</em></strong>” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only.</p>
<p><strong>Power of Images: </strong>If i described in more brief than have an example of comic books where we read the images together with the bubble texts. Have you ever read any comic book in unknown language? May be yes, I think you can go through the whole story of the comics without having the raw knowledge of that language, this is the power of images.</p>
<p>Using relevant and customized images in the blogpost always helps users to understand your points. Their are many ways to choose the images from the websites like <a href="http://flickr.com">flickr</a> , <a href="http://images.google.com">google images</a> and other. Note: You may also use the advance powers of the flickr images search.</p>
<p><img style="border-bottom: 0px; border-left: 0px; margin: 0px auto 10px; display: block; float: none; border-top: 0px; border-right: 0px" title="flickr-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearch1.png" border="0" alt="flickrsearch1 How to choose the best images for the blog posts using Flickr" width="467" height="39" /> Options to search creative and legal images out of the <a href="http://www.flickr.com/search/?q=&amp;w=all">flickr search</a>:</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvance1.png" border="0" alt="flickrsearchadvance1 How to choose the best images for the blog posts using Flickr" width="584" height="95" /></p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearch1.png" border="0" alt="flickrsearchadvancesearch1 How to choose the best images for the blog posts using Flickr" width="582" height="153" /></p>
<p>1.<strong>Creative Commons </strong>licensed Images</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-cc-licensed" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcclicensed1.png" border="0" alt="flickrsearchadvancesearchcclicensed1 How to choose the best images for the blog posts using Flickr" width="559" height="119" /></p>
<p>2.<strong>Search by content type</strong> have the options to have creative, innovative ,artistic images. Here you can also get the Screenshots and Screencasts for your blogposts.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-content" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcontent2.png" border="0" alt="flickrsearchadvancesearchcontent2 How to choose the best images for the blog posts using Flickr" width="564" height="150" /></p>
<p>3.<strong>SafeSearch </strong>options</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-safe" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchsafe1.png" border="0" alt="flickrsearchadvancesearchsafe1 How to choose the best images for the blog posts using Flickr" width="532" height="124" /></p>
<p>4.<strong>Search Photos , Videos or both media types</strong>.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-media-type" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchmediatype1.png" border="0" alt="flickrsearchadvancesearchmediatype1 How to choose the best images for the blog posts using Flickr" width="528" height="150" /></p>
<p>Apart from these manual ways their are several plugins to automatically including images in the wordpress editor. Few of the plugins are <a href="http://wordpress.org/extend/plugins/flickr-post/">Flickr Post</a> , <a href="http://wordpress.org/extend/plugins/wordpress-flickr-manager-1/">WordPress Flickr Manager</a> , <a href="http://wordpress.org/extend/plugins/wp-flickr/">WP-Flickr</a> ,<a href="http://wordpress.org/extend/plugins/pflickr/">Photo of the Day &#8211; flickr widget</a> ,<a href="http://wordpress.org/extend/plugins/scriblio-importer-flickr/">Scriblio flickr Importer</a> ,<a href="http://wordpress.org/extend/plugins/get-flickr-thumbnails/">Get Flickr Thumbnails</a> ,<a href="http://wordpress.org/extend/plugins/simple-flickr-plugin/">Simple Flickr Photos</a> ,<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/">Flickr Feed Gallery</a> and many more.<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/"><br />
</a></p>
<p><strong>Note </strong>: Wait for my upcoming posts on designing customized images for the blog posts. Few pots like “<a href="http://www.techprone.com/future-trends-of-mobile-networking/">Future Trends of Mobile Networking</a>” have light customization over flickr images. You need to note that by giving proper reference of the image source, you are enhancing your own credibility in front of your users. Few other pots like <a href="http://www.techprone.com/5-benefits-of-using-social-bookmarking/">5 benefits of using Social bookmarking</a> are the beautiful examples of designing fully customized images out of your own creativity. So be patience and soon i’ll cover up those easy posts of designing.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276/feed</wfw:commentRss>
		<slash:comments>7</slash:comments>
		</item>
		<item>
		<title>15 plus best adsense plugin for wordpress bloggers</title>
		<link>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693</link>
		<comments>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693#comments</comments>
		<pubDate>Wed, 15 Apr 2009 06:20:07 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[adsense]]></category>
		<category><![CDATA[google]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[bloggers]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=693</guid>
		<description><![CDATA[Every single bloggers wants to earns from their blogs (please leave the page in case you are not interested adsense or wordpress).Here are the 10 best plugins used by the wordpress bloggers for adsense ads networks: AdSense Manager : Allows positioning with widgets AdSense Revenue Sharing 1.2: share your adsense impressions and revenue with your [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Every single bloggers wants to earns from their blogs (please leave the page in case you are not interested adsense or wordpress).Here are the 10 best plugins used by the wordpress bloggers for adsense ads networks: <img style="border-right-width: 0px; display: block; float: none; border-top-width: 0px; border-bottom-width: 0px; margin-left: auto; border-left-width: 0px; margin-right: auto" title="adsense" src="http://cdn.techprone.com/wp-content/uploads/2009/04/adsense.gif" border="0" alt="adsense 15 plus best adsense plugin for wordpress bloggers" width="552" height="221" /></p>
<ol>
<li><a href="http://wordpress.org/extend/plugins/adsense-manager/">AdSense Manager</a> : Allows positioning with widgets</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-revenue-sharing/">AdSense Revenue Sharing 1.2</a>: share your adsense impressions and revenue with your friends and co-authers.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-manager/">AdSense Manager</a> : Allows positioning with widgets</li>
<li><a href="http://www.supriyadisw.net/2006/07/adsense-beautifier">Adsense Beautifier</a> : Increase your adsense earnings by placing beautiful images besides the adsense ads.It increase your clicks (CTR) and subsequent Adsense earnings.</li>
<li><a href="http://wordpress.org/extend/plugins/all-in-one-adsense-and-ypn/">All in One Adsense and YPN</a>: Automatically insert Google <strong>Adsense</strong> or YPN ads anywhere into the post.It will auto generate the adsense code for your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-under-image/">Adsense Under Image</a> : Places specified <strong>Adsense</strong> code under the first image in a post.I personally try it and work awesome for me.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-deluxe2/">Adsense-Deluxe2</a>: Plugin for WPMU and Standalone WordPress with revenue share functionality.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-attachment-plugin/">Adsense Attachment Page</a>: This plugin works best for showing your attachments like images in new page with adsense ads.</li>
<li><a href="http://philhord.com/phord/adsense-inline-with-wordpress-blog-posts/">Adsense Inline</a> –Another adsense plugin for inserting Google adsense in blog posts.</li>
<li><a href="http://wordpress.org/extend/plugins/wordpress-plugin-for-simple-google-adsense-insertion/">WP Simple Adsense Insertion</a>: quickly and easily insert Google Adsense to your posts, pages and sidebar by using a trigger text or calling the php function.</li>
<li><a href="http://wordpress.org/extend/plugins/polite-ifier/">WP-Politifier</a> : enforces a certain level of politeness in your comments, replacing recognized swear words with acronymic asterisks. The original text is preserved in the title attribute, visible on mouseover.</li>
<li><a href="http://wordpress.org/extend/plugins/berri-personalized-care/">Berri Personalized Care</a> : Works best for increasing your feed subscribers, showing publicity to some of your visitors, thanks giving to your visitor from search engines or socialbookmar, showing different messages to your visitants depending on their origin.</li>
<li><a href="http://wordpress.org/extend/plugins/adman/">Adman</a> : Lets you insert your ad-code (like <strong>AdSense</strong>) directly before or in the middle of your post content.You can customize the code anywhere in your layout.</li>
<li>a href=&#8221;http://wordpress.org/extend/plugins/more-from-google/&#8221;&gt;More from Google: Allows you to specify a search term for each post.It encourage readers to stay at your site longer. increase your revenue through Google&#8217;s <strong>AdSense</strong> for Search program.</li>
<li><a href="http://wordpress.org/extend/plugins/profiler/">Profiler</a>: plugin for generating and displaying profiles for the registered users on a WordPress site. Profiler is a plugin for generating and displaying profiles for the registered users on a WordPress site.</li>
<li><a href="http://wordpress.org/extend/plugins/blog-control/">Blog Control</a>: Add scripts from mybloglog, google analytics, <strong>adsense</strong> ther ad network with any need of customizing the templates.</li>
<li><a href="http://wordpress.org/extend/plugins/shantz-wp-prefix-suffix/">Shantz WordPress Prefix Suffix</a> : Another awesome plugin by <a href="http://tech.shantanugoel.com/">shantanu goel</a> for managing adsense beautifully in your blog post.Easy and customizable like <strong>adsense</strong>-manager.</li>
<li><a href="http://blog.taragana.com/index.php/archive/wordpress-plugin-adrotator-rotate-your-ads-including-adsense-dynamically/">AdRotator WordPress Plugin</a> : It rotate the adsense ads together with your personal and other network ads.Helps in earning more,test different ad formats and affiliate programs .</li>
</ol>
<div class="zemanta-related">
<h6 class="zemanta-related-title" style="font-size: 1em">Related articles</h6>
<ul class="zemanta-article-ul">
<li class="zemanta-article-ul-li"><a href="http://www.content123.com/archives/an-adsense-yahoo-publisher-network-comparison/">An Adsense &#8211; Yahoo Publisher Network Comparison</a> (content123.com)</li>
<li class="zemanta-article-ul-li"><a href="http://crenk.com/top-10-adsense-optimized-wordpress-themes/">Top 10 Adsense Optimized WordPress Themes</a> (crenk.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.paidcontent.org/entry/419-google-does-away-with-video-adsense-program/">Google Shutters Video AdSense Program</a> (paidcontent.org)</li>
<li class="zemanta-article-ul-li"><a href="http://techburgh.com/blog/2009/03/20/an-adsense-vs-yahoo-publisher-network-comparison-free-helpful-tips/">An Adsense vs Yahoo Publisher Network Comparison &#8211; Free Helpful Tips</a> (techburgh.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.textually.org/textually/archives/2009/01/022501.htm">iAdsense</a> (textually.org)</li>
<li class="zemanta-article-ul-li"><a href="http://www.techcrunch.com/2009/03/31/google-adsense-says-goodbye-to-video-units-feature/">Google Adsense Says Goodbye To Video Units Feature</a> (techcrunch.com)</li>
</ul>
</div>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693/feed</wfw:commentRss>
		<slash:comments>24</slash:comments>
		</item>
	</channel>
</rss>

<!-- Performance optimized by W3 Total Cache. Learn more: http://www.w3-edge.com/wordpress-plugins/

Minified using disk: basic
Page Caching using disk: enhanced
Content Delivery Network via cdn.techprone.com

Served from: www.techprone.com @ 2012-02-10 10:49:53 -->
