<?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0"
	xmlns:content="http://purl.org/rss/1.0/modules/content/"
	xmlns:wfw="http://wellformedweb.org/CommentAPI/"
	xmlns:dc="http://purl.org/dc/elements/1.1/"
	xmlns:atom="http://www.w3.org/2005/Atom"
	xmlns:sy="http://purl.org/rss/1.0/modules/syndication/"
	xmlns:slash="http://purl.org/rss/1.0/modules/slash/"
	>

<channel>
	<title>Tech Prone - Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android &#187; plugin</title>
	<atom:link href="http://www.techprone.com/tag/plugin/feed/" rel="self" type="application/rss+xml" />
	<link>http://www.techprone.com</link>
	<description>Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android</description>
	<lastBuildDate>Thu, 26 Jan 2012 11:48:16 +0000</lastBuildDate>
	<language>en</language>
	<sy:updatePeriod>hourly</sy:updatePeriod>
	<sy:updateFrequency>1</sy:updateFrequency>
	<generator>http://wordpress.org/?v=3.3.1</generator>
		<item>
		<title>Artsy Editor Makes Blogging Easy and Seamless</title>
		<link>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649</link>
		<comments>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649#comments</comments>
		<pubDate>Mon, 01 Aug 2011 08:07:19 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[application]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[blogging]]></category>
		<category><![CDATA[plugin]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=4649</guid>
		<description><![CDATA[If you are a WordPress user, then this is certainly good news. Artsy Editor, a new WordPress plug-in, helps you get a distraction-free environment while blogging. This plug-in helps bloggers post their blogs easily and quickly. It promises to take just half the time when compared to posting blogs without this plug-in. Some of the [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>If you are a WordPress user, then this is certainly good news. Artsy Editor, a new WordPress plug-in, helps you get a distraction-free environment while blogging. This plug-in helps bloggers post their blogs easily and quickly. It promises to take just half the time when compared to posting blogs without this plug-in.</p>
<p><img class="aligncenter size-full wp-image-4651" title="Artsy editor" src="http://cdn.techprone.com/wp-content/uploads/2011/08/Artsy-editor1.png" alt="Artsy editor1 Artsy Editor Makes Blogging Easy and Seamless" width="560" height="318" /></p>
<p>Some of the interesting features of Artsy Editor includes:</p>
<ul>
<li>Customizing the look and feel of the user interface. Changing background colours, fonts or font sizes all made easy.</li>
<li>Formatting text is simple, selecting text automatically brings up the formatting options in a box that fade ones the text is unselected.</li>
<li>Automatic word and character count is enabled helping writers to keep track of how much is being written.</li>
<li>Images can be placed easily using drag and drop options.</li>
<li>Overlays are removed to make editing content easy.</li>
</ul>
<p>As a HTML-intensive blogger, this may not be the most effective plug-in to have. However, on the other hand if you, as a blogger, like to post long blogs with little HTML requirements, then this plug-in certainly provides a enhanced and more effective experience to blogging.</p>
<p>Needless to say, all good things come with a price. The WordPress plug-ins premium version is priced at $19. It is important to note that this is certainly a reasonable price for the kind of features it offers.</p>
<p><a href="http://artsyeditor.com/">Download Artsy Editor</a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/artsy-editor-makes-blogging-easy-and-seamless/4649/feed</wfw:commentRss>
		<slash:comments>0</slash:comments>
		</item>
		<item>
		<title>How to manage series of posts in wordpress blogs</title>
		<link>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510</link>
		<comments>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510#comments</comments>
		<pubDate>Wed, 09 Sep 2009 22:53:17 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[how to]]></category>
		<category><![CDATA[Plugin]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[plugin]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1510</guid>
		<description><![CDATA[This post is dedicated for those who are into writing any tutorials or posts on particular categories and wants to drag all the posts into a consecutive series of articles. Organize Series WordPress Plugin is the solutions to all your queries. It helps in managing and organizing the series of posts on the basis of  [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>This post is dedicated for those who are into writing any tutorials or posts on particular categories and wants to drag all the posts into a consecutive series of articles.</p>
<p><a href="http://wordpress.org/extend/plugins/organize-series/">Organize Series WordPress Plugin</a> is the solutions to all your queries. It helps in managing and organizing the series of posts on the basis of  <a href="http://codex.wordpress.org/WordPress_Taxonomy">taxonomy</a>.</p>
<h4>Screen Shot of Organize Series Plugin Options</h4>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/09/OrganizeSeriesPluginOptions.png"><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="Organize Series Plugin Options" src="http://cdn.techprone.com/wp-content/uploads/2009/09/OrganizeSeriesPluginOptions_thumb.png" border="0" alt="OrganizeSeriesPluginOptions thumb How to manage series of posts in wordpress blogs" width="574" height="2060" /></a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-manage-series-of-post-in-wordpress-blogs/1510/feed</wfw:commentRss>
		<slash:comments>3</slash:comments>
		</item>
		<item>
		<title>Top 69 WordPress plugins for Twitter</title>
		<link>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469</link>
		<comments>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469#comments</comments>
		<pubDate>Thu, 13 Aug 2009 08:26:54 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Plugin]]></category>
		<category><![CDATA[Tools]]></category>
		<category><![CDATA[twitter]]></category>
		<category><![CDATA[wordpress]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[social media]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1469</guid>
		<description><![CDATA[Managing the twitter together with WordPress blogs is an efficient way to land into social media. You can manage your WordPress blogs together with Twitter upto any extent with the helps of below listed WordPress plugins. Topical Tweets Topical Tweets enables the display of Twitter Updates in your blog for a specific query Tweetable Integrate [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Managing the twitter together with WordPress blogs is an efficient way to land into social media. You can manage your WordPress blogs together with Twitter upto any extent with the helps of below listed WordPress plugins. <img style="border-bottom: 0px; border-left: 0px; display: block; float: none; margin-left: auto; border-top: 0px; margin-right: auto; border-right: 0px" title="69-twitter-plugin" src="http://cdn.techprone.com/wp-content/uploads/2009/08/69twitterplugin.gif" border="0" alt="69twitterplugin Top 69 Wordpress plugins for Twitter" width="567" height="203" /></p>
<ol>
<li><a href="http://wordpress.org/extend/plugins/topical-tweets/">Topical Tweets</a> Topical Tweets enables the display of Twitter Updates in your blog for a specific query</li>
<li><a href="http://wordpress.org/extend/plugins/tweetable/">Tweetable</a> Integrate Twitter with your WordPress blog. Automatically tweet new posts, display your latest tweet in your sidebar, etc.</li>
<li><a href="http://wordpress.org/extend/plugins/advanced-twitter-widget/">Advanced Twitter Widget</a> Widget that will enable visitors to give you/the site a virtual beer by clicking on the widget.</li>
<li><a href="http://wordpress.org/extend/plugins/gigya-socialize-for-wordpress/">Gigya Socialize &#8211; Increase Registration and Engagement using Facebook Connect, Twitter and OpenID</a></li>
<p>Increase your site registration and Engagement using Facebook Connect, MySpaceID, Twitter and OpenID.</p>
<li><a href="http://wordpress.org/extend/plugins/tweelow/">Tweelow Plugin</a> Simple plugin that displays count of your twitter followers.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-liveblog/">Twitter LiveBlog</a></li>
<p>Twitter LiveBlog is a plugin that lets you liveblog on your WordPress blog using Twitter.</p>
<li><a href="http://wordpress.org/extend/plugins/twimp-wp/">Twimp-wp</a></li>
<p>Publish blog posts to multiple twitter accounts.</p>
<li><a href="http://wordpress.org/extend/plugins/twitconnect/">Twit Connect</a></li>
<p>Integrate Twitter and WordPress. Provides single-signon and avatars. Changes in Version 1.11 &#8211; Bug fix for missing &#8216;=&#8217; in login code.</p>
<li><a href="http://wordpress.org/extend/plugins/pretty-link/">Pretty Link</a> Shrink, track and share any URL on the Internet from your WordPress website. Create short links suitable for Twitter using your own domain name!</li>
<li><a href="http://wordpress.org/extend/plugins/db-twtpoll/">dB Twtpoll</a> This plugins adds a shortcode for embedding polls from Twtpoll really easy.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-real-time-search-scrolling/">Twitter real time search scrolling</a> This plug-in will scroll the most recent twittered contents based on the entered search word. Enter search word and see the live content in side bar.</li>
<li><a href="http://wordpress.org/extend/plugins/wordpress-dashboard-twitter/">WordPress Dashboard Twitter</a> The most creative name **WordPress Dashboard Twitter** in fact represents a Dashboard Widget for WordPress, that turns your Dashboard into a Twitter</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-news-feed/">Twitter News Feed</a> Collects Tweets based on specific Twitter usernames and hashtags and then adds them as post</li>
<li><a href="http://wordpress.org/extend/plugins/buzzom-badge-plugin/">Buzzom Badge</a> This plugin let&#8217;s you display a small badge which shows your Buzzom profile.</li>
<li><a href="http://wordpress.org/extend/plugins/wp-twittersearch/">WP-TwitterSearch</a> Displays the latest results based on a twitter search. Options include setting multiple search terms and limiting tweets shown.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tools-google-analytics-tagging/">Twitter Tools &#8211; Google Analytics Tagger</a> Tag all your URL&#8217;s posted to twitter with Google Analytics tags using Twitter Tools</li>
<li><a href="http://wordpress.org/extend/plugins/wp-to-twitter/">WP to Twitter</a> Posts a Twitter status update when you update your WordPress blog or post to your blogroll, using the Cligs URL shortening service.</li>
<li><a href="http://wordpress.org/extend/plugins/twire/">Twire</a> This plugin will bring Twitter functionality to your buddypress installation. You must have 2 things: 1. WordPress MU, 2. Buddy Press</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-bubble/">Twitter Bubble</a> A sidebar widget showing the latest twitter update in a nice talk bubble, suitable for wide sidebars.</li>
<li><a href="http://wordpress.org/extend/plugins/lifestream/">Lifestream</a> Streams your activity from over 50 different sources to your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/easy-retweet/">Easy Retweet</a> Adds a Retweet button to your WordPress posts</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-blog/">Twitter Blog</a> Tweets your post, then captures tweets replying to that tweet and converts them to comments.</li>
<li><a href="http://wordpress.org/extend/plugins/feed2tweet/">Feed2tweet</a> Feed2tweet plugins allows you to publish your new posts to your twitter account.</li>
<li><a href="http://wordpress.org/extend/plugins/zipli-retweet/">Zipli-Retweet</a> Adds a retweet button to all WordPress posts in your blog and update your twitter account with post from your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-friendly-links/">Twitter Friendly Links</a> Your very own TinyURL within your OWN domain! If you DO promote your blog posts in Twitter, then you MUST make your links look cool!</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-followers/">Twitter Followers</a> Display your Twitter followers or people you are following in your sidebar.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-friends-widget/">Twitter Friends Widget</a></li>
<p>Displays your Twitter friends with their profile images in the sidebar.</p>
<li><a href="http://wordpress.org/extend/plugins/tweetmeme/">TweetMeme Button</a></li>
<p>Adds the TweetMeme button into your posts and RSS feed.</p>
<li><a href="http://wordpress.org/extend/plugins/twitpic/">TwitPic</a></li>
<p>Displays your latest pictures from TwitPic in the sidebar of your blog. The plugin is widget ready and comes with many configuration options!</p>
<li><a href="http://wordpress.org/extend/plugins/make-me-social-automatically-submit-posts-to-delicious-twitter-tumblr-diigo/">Make Me Social</a></li>
<p>The &#8220;Make Me Social&#8221; wordpress plugin send each new post you make to the most famous social services.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-publisher/">Twitter Publisher</a> Share a new blog post on Twitter using awe.sm or bit.ly url shorteners.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tools/">Twitter Tools</a> Twitter Tools is a plugin that creates a complete integration between your WordPress blog and your Twitter account.</li>
<li><a href="http://wordpress.org/extend/plugins/lockablog/">Lock a Blog</a></li>
<p>This plugin allows you block content wordpress post for underage readers.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-links-plus/">Twitter Links Plus+</a></li>
<p>Checks Twitter usernames mentioned in the content and in the comments (eg. @tquizzle) with the Twitter service to see if that user is indeed a Twitter</p>
<li><a href="http://wordpress.org/extend/plugins/twitpost/">Twitpost</a></li>
<p>A plugin that posts a short blurb on your Twitter page linking to a post you&#8217;ve recently published.</p>
<li><a href="http://wordpress.org/extend/plugins/comenta-wp/">Comenta WP</a></li>
<p>Publish all your comments directly to a twitter account. You can customize the message published.</p>
<li><a href="http://wordpress.org/extend/plugins/capture-the-conversation/">Capture the Conversation</a></li>
<p>What are people saying about your post, right now?</p>
<li><a href="http://wordpress.org/extend/plugins/twittertowire/">Twitter To Wire</a></li>
<p>This plugin will allow your twits to be automatically added to your Buddy Press wire. You must have 2 things: 1. WordPress MU, 2. Buddy Press</p>
<li><a href="http://wordpress.org/extend/plugins/tweetscribe/">TweetScribe</a></li>
<p>TweetScribe plugin connects your WordPress blog with TweetScribe.me</p>
<li><a href="http://wordpress.org/extend/plugins/pingpressfm/">PingPressFM</a></li>
<p>Allows you to spread your blog to 30+ social networks via ping.fm. Now with support for scheduled posts and custom triggers.</p>
<li><a href="http://wordpress.org/extend/plugins/wickett-twitter-widget/">Wickett Twitter Widget</a>Display tweets from a Twitter account in the sidebar of your blog. As seen on WordPress.com.</li>
<li><a href="http://wordpress.org/extend/plugins/shortcode-shorturl/">Short URL Generator</a></li>
<p>This plugin automatically generates a Short URL for your article. You can choose your favorite provider and get multiple options.</p>
<li><a href="http://wordpress.org/extend/plugins/commentwitter/">Commentwitter</a> Gives commenters the option of Tweeting their comment with a link to your post.</li>
<li><a href="http://wordpress.org/extend/plugins/tweetly-updater/">Tweetly Updater</a></li>
<p>This plugin sends Twitter updates on new or edited posts, uses bit.ly.</p>
<li><a href="http://wordpress.org/extend/plugins/twittersearch/">TwitterSearch</a></li>
<p>TwitterSearch allows users to keep track of twitter search terms from within their wordpress dashboard.</p>
<li><a href="http://wordpress.org/extend/plugins/tracked-tweets/">Tracked Tweets</a></li>
<p>Posts are added to your twitter account. Tweet can be formatted. URL&#8217;s are shortened using Tinyurl or bit.ly, and Google Analytics tracking is added.</p>
<li><a href="http://wordpress.org/extend/plugins/thread-twitter/">Thread Twitter</a></li>
<p>Thread Twitter fetch your tweets and display them in thread style.</p>
<li><a href="http://wordpress.org/extend/plugins/tweet-cloud/">Tweet Cloud</a></li>
<p>Cloud of popular words and phrases from a user&#8217;s Twitter profile.</p>
<li><a href="http://wordpress.org/extend/plugins/rf-twitterpost/">RF Twitter Post</a> A simple plugin that will post to twitter whenever you add a new post to your wordpress blog.</li>
<li><a href="http://wordpress.org/extend/plugins/simple-twitter-link/">Simple Twitter Link</a></li>
<p>Simple Twitter Link displays a link allowing Twitter users to update their status with a link back to your post or page.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-posts/">TwitterPosts</a></li>
<p>This WordPress plugin automatically sends new posts of your blog to twitter as soon as they get published.</p>
<li><a href="http://wordpress.org/extend/plugins/twitter-digest/">Twitter Digest</a></li>
<p>Creates a daily post containing tweets from a twitter account.</p>
<li><a href="http://wordpress.org/extend/plugins/social-media-manager/">Social Media Manager</a></li>
<p>Manage &amp; monitor your social media brand. Facebook, twitter, digg, youtube &amp; tumblr. Post to multiple twitter accounts easy.</p>
<li><a href="http://wordpress.org/extend/plugins/wp-quote-tweets/">WP Quote Tweets</a></li>
<p>Allows authors to quote Twitter updates in posts or pages using a simple shortcode. [quotetweet tweetid=123456789].</p>
<li><a href="http://wordpress.org/extend/plugins/fresh-from-friendfeed-and-twitter/">Fresh From FriendFeed and Twitter</a> Keeps your blog always fresh by regularly adding your latest and greatest content from FriendFeed or Twitter. No external passwords required!</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-profile-field/">Twitter Profile Field</a> Adds an additional field to the user profile page where they can enter their Twitter username.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-tracker/">Twitter Tracker</a></li>
<p>Tracks Twitter search results or a Twitter hashtag in a sidebar widgets.</p>
<li><a href="http://wordpress.org/extend/plugins/social-links-sidebar/">Social Links Sidebar</a></li>
<p>Social Links Sidebar is a sidebar widget that displays icon links to your profile pages on other social networking sites.</p>
<li><a href="http://wordpress.org/extend/plugins/itwitter/">iTwitter</a> Twitter plugin for WordPress. A useful plugin for those who uses Twitter.</li>
<li><a href="http://wordpress.org/extend/plugins/tweet-tweet/">Tweet Tweet</a> Archive your Twitter conversions in your database, and use your free web texts to receive sms notifications.</li>
<li><a href="http://wordpress.org/extend/plugins/twitter-keywords/">Twitter Keywords</a></li>
<p>Add tweets about a certain word, in certain language and from a specific user on your sidebar</p>
<li><a href="http://wordpress.org/extend/plugins/shorten2ping/">Shorten2Ping</a></li>
<p>Sends status updates to Ping.fm or Twitter everytime you publish a post, using Bit.ly or Tr.im for the permalinks.</p>
<li><a href="http://wordpress.org/extend/plugins/twittercounter/">TwitterCounter</a></li>
<p>Integrate TwitterCounter.com badges on your blog to display the number of followers you have on Twitter</p>
<li><a href="http://wordpress.org/extend/plugins/twittley-button/">Twittley button</a></li>
<p>This plugin will install the Twittley button for each of your blog posts in both the content of your posts and the RSS feed.</p>
<li><a href="http://wordpress.org/extend/plugins/twittrup/">Twittrup</a></li>
<p>Updates Twitter when you create a new blog post utilizing an shortener service of your choice.</p>
<li><a href="http://wordpress.org/extend/plugins/tweet-blender/">Tweet Blender</a></li>
<p>Adds Twitter sidebar widget and creates an archive page. Blends Twitter tweets for multiple screen names, hashtags and/or keywords into a single stream.</p>
<li><a href="http://wordpress.org/extend/plugins/backtype-connect/">BackType Connect</a> The BackType Connect WordPress plugin lets you show related conversations (from Twitter, Digg, FriendFeed &amp; more) inline with your own comments.</li>
<li><a href="http://wordpress.org/extend/plugins/wp-bar/">The WordPress Bar</a> Seen the DiggBar on Digg.com? Add a similar feature to your WordPress blog by creating a navigation bar for all external links outside of blog.</li>
<li><a href="http://wordpress.org/extend/plugins/yourls-wordpress-to-twitter/">YOURLS: WordPress to Twitter</a></li>
<p>Use YOURLS (a free GPL URL shortener service) or another public service (tinyURL&#8230;) to create short URL of your posts and tweet them.</ol>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/top-69-wordpress-plugins-for-twitter/1469/feed</wfw:commentRss>
		<slash:comments>9</slash:comments>
		</item>
		<item>
		<title>WP-Super-Cache comes with new check list of Accepted Filenames &amp; Rejected URIs</title>
		<link>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409</link>
		<comments>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409#comments</comments>
		<pubDate>Sun, 02 Aug 2009 17:36:34 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Plugin]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[web]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1409</guid>
		<description><![CDATA[I assumed that you know about one of the most brilliant WordPress Plugin, WP Super Cache, used to enhance the website / blog performance by increasing its loading time. If you doesn’t hear about it then on a simple note its functionality can be described as This plugin generates static html files from your dynamic [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>I assumed that you know about one of the most brilliant WordPress Plugin, <a href="http://wordpress.org/extend/plugins/wp-super-cache/">WP Super Cache</a>, used to enhance the website / blog performance by increasing its loading time. If you doesn’t hear about it then on a simple note its functionality can be described as</p>
<blockquote><p>This plugin generates static html files from your dynamic WordPress blog. After a html file is generated your webserver will serve that file instead of processing the comparatively heavier and more expensive WordPress PHP scripts.</p>
<p>The static html files will be served to the vast majority of your users, but because a user&#8217;s details are displayed in the comment form after they leave a comment those requests are handled by PHP. Static files are served to:</p>
<ol>
<li>Users who are not logged in.</li>
<li>Users who have not left a comment on your blog.</li>
<li>Or users who have not viewed a password protected post.</li>
</ol>
</blockquote>
<p>Thanks to <a href="http://twitter.com/Donncha">Donncha</a> for creating this awesome plugin. Now the what’s the point of this blog post? This blog post aims toward the recent update in the <a href="http://wordpress.org/extend/plugins/wp-super-cache/">WP Super Cache</a> where it comes with new check list of <strong>Accepted Filenames &amp; Rejected URIs</strong>. Initially we used to defined the manual file names with php extensions for the rejection of the <a class="zem_slink" title="Cache" rel="wikipedia" href="http://en.wikipedia.org/wiki/Cache">caching</a> but now it work even beyond that.</p>
<pre class="csharpcode">wp-.*\.php
index\.php</pre>
<p><!--</p>
<p>.csharpcode, .csharpcode pre<br />
{<br />
font-size: small;<br />
color: black;<br />
font-family: consolas, "Courier New", courier, monospace;<br />
background-color: #ffffff;<br />
/*white-space: pre;*/<br />
}<br />
.csharpcode pre { margin: 0em; }<br />
.csharpcode .rem { color: #008000; }<br />
.csharpcode .kwrd { color: #0000ff; }<br />
.csharpcode .str { color: #006080; }<br />
.csharpcode .op { color: #0000c0; }<br />
.csharpcode .preproc { color: #cc6633; }<br />
.csharpcode .asp { background-color: #ffff00; }<br />
.csharpcode .html { color: #800000; }<br />
.csharpcode .attr { color: #ff0000; }<br />
.csharpcode .alt<br />
{<br />
background-color: #f4f4f4;<br />
width: 100%;<br />
margin: 0em;<br />
}<br />
.csharpcode .lnum { color: #606060; } --></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="wp-super-cache" src="http://cdn.techprone.com/wp-content/uploads/2009/08/wpsupercache.png" border="0" alt="wpsupercache WP Super Cache comes with new check list of Accepted Filenames &amp; Rejected URIs" width="519" height="342" /></p>
<p>Now the check list comes with the options of <a href="http://codex.wordpress.org/Conditional_Tags">Conditional Tags</a> (Tags used to define the conditions of the contents in the templates). The main changes in the recent 0.9.6.1 updates are listed below:</p>
<blockquote><p>1. Ability to move &#8220;not logged in&#8221; message init below check for POST.</p>
<p>2. Options to add is_admin() check so plugin definitely can&#8217;t cache the backend.</p>
<p>3. Options to add &#8220;do not cache&#8221; page type to admin page.</p></blockquote>
<p>What is the benefits ?</p>
<p>Now the page which changes most like your home page , front page loads the recent updates and changes with any hassle of clearing the cache.</p>
<div class="zemanta-related">
<h6 class="zemanta-related-title" style="font-size: 1em">Related articles that inforce the use of WP-Super-Cache and recognised by other:</h6>
<ul class="zemanta-article-ul">
<li class="zemanta-article-ul-li"><a href="http://www.blogherald.com/2009/07/30/wp-super-cache-gets-bumped-to-0-9-6-1/">WP Super Cache Gets Bumped to 0.9.6.1</a> (blogherald.com)</li>
<li class="zemanta-article-ul-li"><a href="http://r.zemanta.com/?u=http%3A//www.wizardstower.co.uk/wordpress/2009/04/06/db-cache-plugin-for-wordpress/&amp;a=4522171&amp;rid=2b7e50b4-c2ca-4da5-bb79-b2e6b8ab1092&amp;e=fa1c1b0be028a9e0c4a54c85c7e9abc9">DB Cache plugin for WordPress</a> (wizardstower.co.uk)</li>
<li class="zemanta-article-ul-li"><a href="http://www.noupe.com/wordpress/13-great-wordpress-speed-tips-tricks-for-max-performance.html">13 Great WordPress Speed Tips &amp; Tricks for MAX Performance</a> (noupe.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.dbms2.com/2009/07/28/oops-i-didnt-have-caching-turned-on/">Oops, I didn&#8217;t have caching turned on</a> (dbms2.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.smtusa.com/blog/posts/Top-Five-Wordpress-Plugins.html">Top Five WordPress Plugins</a> (smtusa.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.blogherald.com/2009/04/27/5-wordpress-plugins-i-never-blog-without/">5 WordPress Plugins I Never Blog Without</a> (blogherald.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.newofferings.com/wordpress/12-wordpress-plugins-that-you-must-have/">12 WordPress Plugins That You Must Have</a> (newofferings.com)</li>
</ul>
</div>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/wp-super-cache-comes-with-new-check-list-of-accepted-filenames-rejected-uri/1409/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed</title>
		<link>http://www.techprone.com/speed-test-google-chrome-plugin/1378</link>
		<comments>http://www.techprone.com/speed-test-google-chrome-plugin/1378#comments</comments>
		<pubDate>Fri, 24 Jul 2009 16:58:51 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Chrome]]></category>
		<category><![CDATA[bookmarking]]></category>
		<category><![CDATA[extension]]></category>
		<category><![CDATA[plugin]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1378</guid>
		<description><![CDATA[Speed  Test is Google Chrome Plugin for checking the bandwidth of your internet connection. It is a type of internet speed meter which calculates the current bandwidth reading of your internet connections. You can install this plugin on your Google Chrome Browser in any of two ways either by Bookmarklet or by core extensions (speedtest.crx [...]]]></description>
			<content:encoded><![CDATA[<p></p><p><strong>Speed  Test</strong> is <strong>Google Chrome Plugin</strong> for checking the bandwidth of your internet connection. It is a type of <a href="http://www.guidingtech.com/1836/5-power-tools-to-check-broadband-speed-and-quality/">internet speed</a> meter which calculates the current bandwidth reading of your internet connections.</p>
<p>You can install this plugin on your Google Chrome Browser in any of two ways either by Bookmarklet or by core extensions (<a href="http://www.techprone.com/download/Speedtest.crx">speedtest.crx</a> file working on Google Chrome <a href="http://www.google.com/chrome/eula.html?extra=devchannel">developers</a> and <a href="http://www.google.com/chrome/eula.html?extra=betachannel">beta</a> versions)</p>
<p><img style="border-right-width: 0px; margin: 0px 0px 15px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="speedtest-post" src="http://cdn.techprone.com/wp-content/uploads/2009/07/speedtestpost.png" border="0" alt="speedtestpost Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed" width="570" height="171" /></p>
<h4>Screenshot of<strong> Speed Test </strong>Google Chrome Extension</h4>
<h6><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="screenshot" src="http://cdn.techprone.com/wp-content/uploads/2009/07/screenshot.png" border="0" alt="screenshot Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed" width="448" height="510" /></h6>
<h3>1.As a Bookmarklet</h3>
<p><a href="http://www.honeytechblog.com/google-chrome-plugin-ip-address-checker/">Google Chrome Bookmarklet Plugin for Instant IP checker</a> have the detailed tutorial of installing the bookmarklet on Chrome browsers. You need to enable the bookmarks bar of the Chrome from the <strong>Tools</strong> -&gt; <strong>Always show bookmarks bar</strong>.</p>
<p><strong>How To Add Page in Google Chrome</strong></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="add-page" src="http://cdn.techprone.com/wp-content/uploads/2009/07/addpage.png" border="0" alt="addpage Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed" width="594" height="322" /></p>
<p><strong>How to add /Edit Bookmark</strong></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="add-bookmark" src="http://cdn.techprone.com/wp-content/uploads/2009/07/addbookmark_thumb.png" border="0" alt="addbookmark thumb Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed" width="455" height="463" /></p>
<p>Note: You need to enter the values Name= <strong>Speed Test </strong>and the below code in the place of <strong>URL</strong></p>
<pre class="csharpcode">javascript:void(window.open("http://www.techprone.com/bandwidth-meter/chrome.php", "What%20is%20My%20IP","width=400,height=400,top=300,left=0,toolbar=no,location=no,directories=no,status=no,menubar=no"))</pre>
<p><!-- .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } --><!-- .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } --></p>
<p>Speed Test Icon at the bookmarks bar of Google Chrome will look like this</p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="speed-test-icon" src="http://cdn.techprone.com/wp-content/uploads/2009/07/speedtesticon.png" border="0" alt="speedtesticon Speed Test: Google Chrome Plugin for checking Internet Bandwidth Speed" width="479" height="206" /></p>
<h3>2.As an Extenstions</h3>
<p>On <a href="http://www.honeytechblog.com/google-chrome-extension-for-checking-ip/">Google Chrome extension for checking IP</a> their is a nice tutorial of “<a href="http://www.honeytechblog.com/google-chrome-extension-for-checking-ip/">How to install extensions for Google Chrome</a>”.</p>
<blockquote><p>The basic requirement to run the extensions is the <a href="http://www.google.com/chrome/eula.html?extra=devchannel"><strong>Google Chrome developer version</strong></a> installed in your system. After installing <a href="http://www.google.com/chrome/eula.html?extra=devchannel">developers</a> and <a href="http://www.google.com/chrome/eula.html?extra=betachannel">beta</a> versions you need to go to the Google Chrome icon on the desktop. On the Chrome icon Right click and go to the <strong>properties</strong> then Go to <strong>Shortcuts</strong> and add the <strong><em>–enable-extensions</em></strong> in the end. (for example <em>C:\Users\honey\AppData\Local\Google\Chrome\Application\chrome.exe –enable-extensions</em> ). After all this Restart / Launch the Google Chrome.</p></blockquote>
<p><strong>Install <strong><a href="http://www.techprone.com/download/Speedtest.crx">Speed Test</a></strong></strong></p>
<ul>
<li><strong>Extension</strong>: speedtest.crx          <a class="downloadlink" href="http://www.techprone.com/download/Speedtest.crx" title="Version1.0 downloaded 1851 times" >Speed Test (1851)</a></li>
<li><strong>File size</strong>:4.65 KB</li>
<li><strong>Last Build</strong>: July 24, 2009</li>
<li><strong>Requirement</strong>: At least Google Chrome Developer Version 3.0.189.0 ( Current Version on July 23 3.0.195.1 )</li>
</ul>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/speed-test-google-chrome-plugin/1378/feed</wfw:commentRss>
		<slash:comments>9</slash:comments>
		</item>
		<item>
		<title>How to choose the best images for the blog posts using Flickr</title>
		<link>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276</link>
		<comments>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276#comments</comments>
		<pubDate>Mon, 06 Jul 2009 10:38:43 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Flickr]]></category>
		<category><![CDATA[free]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[blog]]></category>
		<category><![CDATA[bloggers]]></category>
		<category><![CDATA[blogging]]></category>
		<category><![CDATA[image editing]]></category>
		<category><![CDATA[image flickr]]></category>
		<category><![CDATA[Images]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1276</guid>
		<description><![CDATA[As we all know that “content is the king” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only. Power of Images: If i described in more [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>As we all know that “<strong><em>content is the king</em></strong>” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only.</p>
<p><strong>Power of Images: </strong>If i described in more brief than have an example of comic books where we read the images together with the bubble texts. Have you ever read any comic book in unknown language? May be yes, I think you can go through the whole story of the comics without having the raw knowledge of that language, this is the power of images.</p>
<p>Using relevant and customized images in the blogpost always helps users to understand your points. Their are many ways to choose the images from the websites like <a href="http://flickr.com">flickr</a> , <a href="http://images.google.com">google images</a> and other. Note: You may also use the advance powers of the flickr images search.</p>
<p><img style="border-bottom: 0px; border-left: 0px; margin: 0px auto 10px; display: block; float: none; border-top: 0px; border-right: 0px" title="flickr-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearch1.png" border="0" alt="flickrsearch1 How to choose the best images for the blog posts using Flickr" width="467" height="39" /> Options to search creative and legal images out of the <a href="http://www.flickr.com/search/?q=&amp;w=all">flickr search</a>:</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvance1.png" border="0" alt="flickrsearchadvance1 How to choose the best images for the blog posts using Flickr" width="584" height="95" /></p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearch1.png" border="0" alt="flickrsearchadvancesearch1 How to choose the best images for the blog posts using Flickr" width="582" height="153" /></p>
<p>1.<strong>Creative Commons </strong>licensed Images</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-cc-licensed" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcclicensed1.png" border="0" alt="flickrsearchadvancesearchcclicensed1 How to choose the best images for the blog posts using Flickr" width="559" height="119" /></p>
<p>2.<strong>Search by content type</strong> have the options to have creative, innovative ,artistic images. Here you can also get the Screenshots and Screencasts for your blogposts.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-content" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcontent2.png" border="0" alt="flickrsearchadvancesearchcontent2 How to choose the best images for the blog posts using Flickr" width="564" height="150" /></p>
<p>3.<strong>SafeSearch </strong>options</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-safe" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchsafe1.png" border="0" alt="flickrsearchadvancesearchsafe1 How to choose the best images for the blog posts using Flickr" width="532" height="124" /></p>
<p>4.<strong>Search Photos , Videos or both media types</strong>.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-media-type" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchmediatype1.png" border="0" alt="flickrsearchadvancesearchmediatype1 How to choose the best images for the blog posts using Flickr" width="528" height="150" /></p>
<p>Apart from these manual ways their are several plugins to automatically including images in the wordpress editor. Few of the plugins are <a href="http://wordpress.org/extend/plugins/flickr-post/">Flickr Post</a> , <a href="http://wordpress.org/extend/plugins/wordpress-flickr-manager-1/">WordPress Flickr Manager</a> , <a href="http://wordpress.org/extend/plugins/wp-flickr/">WP-Flickr</a> ,<a href="http://wordpress.org/extend/plugins/pflickr/">Photo of the Day &#8211; flickr widget</a> ,<a href="http://wordpress.org/extend/plugins/scriblio-importer-flickr/">Scriblio flickr Importer</a> ,<a href="http://wordpress.org/extend/plugins/get-flickr-thumbnails/">Get Flickr Thumbnails</a> ,<a href="http://wordpress.org/extend/plugins/simple-flickr-plugin/">Simple Flickr Photos</a> ,<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/">Flickr Feed Gallery</a> and many more.<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/"><br />
</a></p>
<p><strong>Note </strong>: Wait for my upcoming posts on designing customized images for the blog posts. Few pots like “<a href="http://www.techprone.com/future-trends-of-mobile-networking/">Future Trends of Mobile Networking</a>” have light customization over flickr images. You need to note that by giving proper reference of the image source, you are enhancing your own credibility in front of your users. Few other pots like <a href="http://www.techprone.com/5-benefits-of-using-social-bookmarking/">5 benefits of using Social bookmarking</a> are the beautiful examples of designing fully customized images out of your own creativity. So be patience and soon i’ll cover up those easy posts of designing.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276/feed</wfw:commentRss>
		<slash:comments>7</slash:comments>
		</item>
		<item>
		<title>15 plus best adsense plugin for wordpress bloggers</title>
		<link>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693</link>
		<comments>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693#comments</comments>
		<pubDate>Wed, 15 Apr 2009 06:20:07 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[adsense]]></category>
		<category><![CDATA[google]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[bloggers]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=693</guid>
		<description><![CDATA[Every single bloggers wants to earns from their blogs (please leave the page in case you are not interested adsense or wordpress).Here are the 10 best plugins used by the wordpress bloggers for adsense ads networks: AdSense Manager : Allows positioning with widgets AdSense Revenue Sharing 1.2: share your adsense impressions and revenue with your [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Every single bloggers wants to earns from their blogs (please leave the page in case you are not interested adsense or wordpress).Here are the 10 best plugins used by the wordpress bloggers for adsense ads networks: <img style="border-right-width: 0px; display: block; float: none; border-top-width: 0px; border-bottom-width: 0px; margin-left: auto; border-left-width: 0px; margin-right: auto" title="adsense" src="http://cdn.techprone.com/wp-content/uploads/2009/04/adsense.gif" border="0" alt="adsense 15 plus best adsense plugin for wordpress bloggers" width="552" height="221" /></p>
<ol>
<li><a href="http://wordpress.org/extend/plugins/adsense-manager/">AdSense Manager</a> : Allows positioning with widgets</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-revenue-sharing/">AdSense Revenue Sharing 1.2</a>: share your adsense impressions and revenue with your friends and co-authers.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-manager/">AdSense Manager</a> : Allows positioning with widgets</li>
<li><a href="http://www.supriyadisw.net/2006/07/adsense-beautifier">Adsense Beautifier</a> : Increase your adsense earnings by placing beautiful images besides the adsense ads.It increase your clicks (CTR) and subsequent Adsense earnings.</li>
<li><a href="http://wordpress.org/extend/plugins/all-in-one-adsense-and-ypn/">All in One Adsense and YPN</a>: Automatically insert Google <strong>Adsense</strong> or YPN ads anywhere into the post.It will auto generate the adsense code for your blog.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-under-image/">Adsense Under Image</a> : Places specified <strong>Adsense</strong> code under the first image in a post.I personally try it and work awesome for me.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-deluxe2/">Adsense-Deluxe2</a>: Plugin for WPMU and Standalone WordPress with revenue share functionality.</li>
<li><a href="http://wordpress.org/extend/plugins/adsense-attachment-plugin/">Adsense Attachment Page</a>: This plugin works best for showing your attachments like images in new page with adsense ads.</li>
<li><a href="http://philhord.com/phord/adsense-inline-with-wordpress-blog-posts/">Adsense Inline</a> –Another adsense plugin for inserting Google adsense in blog posts.</li>
<li><a href="http://wordpress.org/extend/plugins/wordpress-plugin-for-simple-google-adsense-insertion/">WP Simple Adsense Insertion</a>: quickly and easily insert Google Adsense to your posts, pages and sidebar by using a trigger text or calling the php function.</li>
<li><a href="http://wordpress.org/extend/plugins/polite-ifier/">WP-Politifier</a> : enforces a certain level of politeness in your comments, replacing recognized swear words with acronymic asterisks. The original text is preserved in the title attribute, visible on mouseover.</li>
<li><a href="http://wordpress.org/extend/plugins/berri-personalized-care/">Berri Personalized Care</a> : Works best for increasing your feed subscribers, showing publicity to some of your visitors, thanks giving to your visitor from search engines or socialbookmar, showing different messages to your visitants depending on their origin.</li>
<li><a href="http://wordpress.org/extend/plugins/adman/">Adman</a> : Lets you insert your ad-code (like <strong>AdSense</strong>) directly before or in the middle of your post content.You can customize the code anywhere in your layout.</li>
<li>a href=&#8221;http://wordpress.org/extend/plugins/more-from-google/&#8221;&gt;More from Google: Allows you to specify a search term for each post.It encourage readers to stay at your site longer. increase your revenue through Google&#8217;s <strong>AdSense</strong> for Search program.</li>
<li><a href="http://wordpress.org/extend/plugins/profiler/">Profiler</a>: plugin for generating and displaying profiles for the registered users on a WordPress site. Profiler is a plugin for generating and displaying profiles for the registered users on a WordPress site.</li>
<li><a href="http://wordpress.org/extend/plugins/blog-control/">Blog Control</a>: Add scripts from mybloglog, google analytics, <strong>adsense</strong> ther ad network with any need of customizing the templates.</li>
<li><a href="http://wordpress.org/extend/plugins/shantz-wp-prefix-suffix/">Shantz WordPress Prefix Suffix</a> : Another awesome plugin by <a href="http://tech.shantanugoel.com/">shantanu goel</a> for managing adsense beautifully in your blog post.Easy and customizable like <strong>adsense</strong>-manager.</li>
<li><a href="http://blog.taragana.com/index.php/archive/wordpress-plugin-adrotator-rotate-your-ads-including-adsense-dynamically/">AdRotator WordPress Plugin</a> : It rotate the adsense ads together with your personal and other network ads.Helps in earning more,test different ad formats and affiliate programs .</li>
</ol>
<div class="zemanta-related">
<h6 class="zemanta-related-title" style="font-size: 1em">Related articles</h6>
<ul class="zemanta-article-ul">
<li class="zemanta-article-ul-li"><a href="http://www.content123.com/archives/an-adsense-yahoo-publisher-network-comparison/">An Adsense &#8211; Yahoo Publisher Network Comparison</a> (content123.com)</li>
<li class="zemanta-article-ul-li"><a href="http://crenk.com/top-10-adsense-optimized-wordpress-themes/">Top 10 Adsense Optimized WordPress Themes</a> (crenk.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.paidcontent.org/entry/419-google-does-away-with-video-adsense-program/">Google Shutters Video AdSense Program</a> (paidcontent.org)</li>
<li class="zemanta-article-ul-li"><a href="http://techburgh.com/blog/2009/03/20/an-adsense-vs-yahoo-publisher-network-comparison-free-helpful-tips/">An Adsense vs Yahoo Publisher Network Comparison &#8211; Free Helpful Tips</a> (techburgh.com)</li>
<li class="zemanta-article-ul-li"><a href="http://www.textually.org/textually/archives/2009/01/022501.htm">iAdsense</a> (textually.org)</li>
<li class="zemanta-article-ul-li"><a href="http://www.techcrunch.com/2009/03/31/google-adsense-says-goodbye-to-video-units-feature/">Google Adsense Says Goodbye To Video Units Feature</a> (techcrunch.com)</li>
</ul>
</div>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/15-plus-best-adsense-plugin-for-wordpress-bloggers/693/feed</wfw:commentRss>
		<slash:comments>24</slash:comments>
		</item>
	</channel>
</rss>

<!-- Performance optimized by W3 Total Cache. Learn more: http://www.w3-edge.com/wordpress-plugins/

Minified using disk: basic
Page Caching using disk: enhanced
Content Delivery Network via cdn.techprone.com

Served from: www.techprone.com @ 2012-02-10 09:54:35 -->
