<?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0"
	xmlns:content="http://purl.org/rss/1.0/modules/content/"
	xmlns:wfw="http://wellformedweb.org/CommentAPI/"
	xmlns:dc="http://purl.org/dc/elements/1.1/"
	xmlns:atom="http://www.w3.org/2005/Atom"
	xmlns:sy="http://purl.org/rss/1.0/modules/syndication/"
	xmlns:slash="http://purl.org/rss/1.0/modules/slash/"
	>

<channel>
	<title>Tech Prone - Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android &#187; Best</title>
	<atom:link href="http://www.techprone.com/category/best/feed/" rel="self" type="application/rss+xml" />
	<link>http://www.techprone.com</link>
	<description>Mobile &#124; Gadgets &#124; Photography &#124; How to &#124; Android</description>
	<lastBuildDate>Thu, 26 Jan 2012 11:48:16 +0000</lastBuildDate>
	<language>en</language>
	<sy:updatePeriod>hourly</sy:updatePeriod>
	<sy:updateFrequency>1</sy:updateFrequency>
	<generator>http://wordpress.org/?v=3.3.1</generator>
		<item>
		<title>Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]</title>
		<link>http://www.techprone.com/samsung-galaxy-nexus-running-andorid/6833</link>
		<comments>http://www.techprone.com/samsung-galaxy-nexus-running-andorid/6833#comments</comments>
		<pubDate>Thu, 17 Nov 2011 20:39:25 +0000</pubDate>
		<dc:creator>sandhuharv</dc:creator>
				<category><![CDATA[Android]]></category>
		<category><![CDATA[application]]></category>
		<category><![CDATA[Best]]></category>
		<category><![CDATA[Mobile]]></category>
		<category><![CDATA[Samsung]]></category>
		<category><![CDATA[android]]></category>
		<category><![CDATA[Ice Cream Sandwich]]></category>
		<category><![CDATA[Samsung Galaxy Nexus]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=6833</guid>
		<description><![CDATA[Samsung, the Japanese smartphone manufacturer, have released their latest smartphone the Samsung Galaxy Nexus. The Samsung Nexus is a highly anticipated phone because it is the first smartphone to run the new Android operating system, Android Ice Cream Sandwich (v4.0). Exclusive Hands on Image of Samsung Galaxy Nexus The phone has a large 4.65inch display, [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Samsung, the Japanese smartphone manufacturer, have released their latest smartphone the Samsung Galaxy Nexus. The Samsung Nexus is a highly anticipated phone because it is the first smartphone to run the new Android operating system, Android Ice Cream Sandwich (v4.0).</p>
<h3>Exclusive Hands on Image of Samsung Galaxy Nexus</h3>
<p><img class="aligncenter size-medium wp-image-6839" src="http://cdn.techprone.com/wp-content/uploads/2011/11/Galaxy-Nexus.jpg" alt="Galaxy Nexus Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" width="620" title="Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" /></p>
<p>The phone has a large 4.65inch display, putting it ahead of many smartphones. The screen has a resolution of 1280 x 720 pixels, providing a really crisp and clear image. The smartphone also features the Samsung Super AMOLED technology, not quite the Plus technology seen on the Samsung Galaxy S 2 however. The screen is almost on the same level as the iPhone 4S but on a slightly large scale. If you want to compare it with other device then do checkout <a href="http://www.honeytechblog.com/samsung-galaxy-note-vs-google-nexus-prime-hands-on/">Samsung Galaxy Note Vs Google Galaxy Nexus Prime [Hands on comparison with images]</a></p>
<p>With dimensions of 135.5 x 67.9 x 8.9mm the phone fits in the hand nicely. Weighing a decent 135g it also sits in pockets easily and is not bulky at all. The phone is quite thin at 8.9mm but still has a sturdy feel to it. It is very slightly thicker, 0.3mm, than the Galaxy S 2 though.</p>
<p><img class="aligncenter size-medium wp-image-6839" src="http://i.honeytechblog.com/2011/11/Galaxy-Note-vs-Google-Nexus.jpg" alt="Galaxy Note vs Google Nexus Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" width="620" title="Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" /></p>
<p>The Samsung Galaxy Nexus has a dual core 1.2GHz Coretex A9 processor with 1GB of RAM. The hardware inside the phone puts it on par with the ebst smartphones on the market and it just pips the iPhone when it comes to the speed of taking photos.</p>
<p style="text-align: center"><img class="aligncenter size-full wp-image-6836" src="http://cdn.techprone.com/wp-content/uploads/2011/11/96539-compare-nexus-s-to-samsung-galaxy-s-4g.png" alt="96539 compare nexus s to samsung galaxy s 4g Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" width="400" height="400" title="Samsung Galaxy Nexus, running Andorid Ice Cream Sandwich [Exclusive Image]" /></p>
<p>This leads me onto the camera which is 5 megapixels. This may be considered low in this day and age, especially compared to the many 8 megapixel smartphones available. However the picture quality is awesome and really impressive considering it is &#8216;only&#8217; 5 megapixels. The Nexus can also record in full HD, 1080p, putting it on par with the new iPhone 4S. The front facing camera is also decent at 1.3 megapixels, perfect for video calls.</p>
<p>Another area where the dual core processor comes into play is general use of the phone. Switching between apps and multi-tasking is done with ease, better than most Android phones on the market.</p>
<p>Using the internet on the Samsung Galaxy Nexus was similarly fast. With the great screen quality images appear crystal clear as does the text at full zoom. One thing Android has which Apple don&#8217;t is Flash. Flash videos can be played on the Galaxy Nexus and look brilliant on screen.</p>
<p>Being the first phone to run Android Ice Cream Sandwich you can forgive any bugs. However we found that the Nexus and new Android OS complimented each other perfectly. The interaction is much slicker and the OS in general much more simpler to use. It also sees NFC technology being used with Android Beam. You can share bookmarks and images with other Android Bean devices really quickly.</p>
<p>Overall the Samsung Galaxy Nexus is a great smartphone. It is obvious that this is a &#8216;flagship&#8217; Android model with lots of effort by both Google and Samsung. The phone is impressive despite maybe it&#8217;s slightly below par specs. This is mainly due to the ease of use of Ice Cream Sandwich and overall integration between the hardware and software.</p>
<p>The large screen is great for watching films, recording videos or taking pictures. Browsing the internet is a joy and we can see the Samsung Galaxy Nexus becoming very popular in the near future!</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/samsung-galaxy-nexus-running-andorid/6833/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>10 useful sites to download Android Applications</title>
		<link>http://www.techprone.com/10-sites-download-android-applications/5185</link>
		<comments>http://www.techprone.com/10-sites-download-android-applications/5185#comments</comments>
		<pubDate>Sun, 25 Sep 2011 19:16:59 +0000</pubDate>
		<dc:creator>shaw</dc:creator>
				<category><![CDATA[application]]></category>
		<category><![CDATA[Best]]></category>
		<category><![CDATA[Mobile]]></category>
		<category><![CDATA[Top 10]]></category>
		<category><![CDATA[Android app]]></category>
		<category><![CDATA[Android applications]]></category>
		<category><![CDATA[applications]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=5185</guid>
		<description><![CDATA[There are almost tons of websites when it comes to download the best of Android apps. Here we will write down about the top ten websites that can help in making any android phone more stylish and manageable. Amazon AppStore It comes under Amazon.com foray. It gives off best organizational system to get the best [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>There are almost tons of websites when it comes to download the best of Android apps. Here we will write down about the top ten websites that can help in making any android phone more stylish and manageable.</p>
<h3>Amazon AppStore</h3>
<p> It comes under Amazon.com foray. It gives off best organizational system to get the best of android apps. <a href="http://www.amazon.com/mobile-apps/b?ie=UTF8&amp;node=2350149011">http://www.amazon.com/mobile-apps/b?ie=UTF8&amp;node=2350149011#</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Amazon.com-Appstore-for-Android.png" alt="Amazon.com Appstore for Android 10 useful sites to download Android Applications " title="Amazon.com- Appstore for Android" width="640" class="aligncenter size-full wp-image-5359" /></p>
<h3>Android Tapp</h3>
<p> App reviews, recommendations and interviews of developers are provided here. Different categorical design helps you to find best apps searched. <a href="http://www.androidtapp.com/">http://www.androidtapp.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Android-Tapp.-Android-App-Reviews-Android-Apps-News-App-Recommendations-Interviews.png" alt="Android Tapp. Android App Reviews Android Apps News App Recommendations Interviews 10 useful sites to download Android Applications " title="Android Tapp. Android App Reviews, Android Apps, News, App Recommendations, Interviews" width="640" class="aligncenter size-full wp-image-5362" /></p>
<h3>Appitalism</h3>
<p> It is also famous for being Social App superstore. Here users collectively determine the best apps. <a href="http://in.appitalism.com/">http://in.appitalism.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Appitalism-The-Social-App-Store.png" alt="Appitalism The Social App Store 10 useful sites to download Android Applications " title="Appitalism- The Social App Store" width="640" class="aligncenter size-full wp-image-5363" /></p>
<h3>Appbrain</h3>
<p> One of the best android apps download could be easily found to be here. In accordance with reviews, rankings and category, best of android apps can be browsed. <a href="http://www.appbrain.com/">http://www.appbrain.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Top-Android-Apps-and-Games-in-the-Android-Market-AppBrain.com_.png" alt="Top Android Apps and Games in the Android Market AppBrain.com  10 useful sites to download Android Applications " title="Top Android Apps and Games in the Android Market - AppBrain.com" width="640" class="aligncenter size-full wp-image-5368" /></p>
<h3>Appguide</h3>
<p> Appguide is one of the parts of the PCworld.com group. Browsing and searching for the best of apps available in the store. <a href="http://www.pcworld.com/appguide/index.html?platform=2">http://www.pcworld.com/appguide/index.html?platform=2</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Android-App-Reviews-by-the-Experts-at-PCWorld-PCWorld.png" alt="Android App Reviews by the Experts at PCWorld PCWorld 10 useful sites to download Android Applications " title="Android App Reviews by the Experts at PCWorld - PCWorld" width="640" class="aligncenter size-full wp-image-5360" /></p>
<h3>Appolicious</h3>
<p> This is a website that will recommend you the apps that your friends are using on face book.<a href="http://www.androidapps.com/"> http://www.androidapps.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Android-Apps-Appolicious-™-App-Directory.png" alt="Android Apps Appolicious ™ App Directory 10 useful sites to download Android Applications " title="Android Apps - Appolicious ™ App Directory" width="640" class="aligncenter size-full wp-image-5361" /></p>
<h3>Aproov</h3>
<p> This website has a self algorithm called Apprank. This gives you the ability to search and filter by category. <a href="http://www.aproov.com/">http://www.aproov.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Aproov.png" alt="Aproov 10 useful sites to download Android Applications " title="Aproov" width="640"  class="aligncenter size-full wp-image-5365" /></p>
<h3>Android Market</h3>
<p> This is one of the original website that is very well laid out. This visually appealing website helps in easy search with the android applications. <a href="https://market.android.com/">https://market.android.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/Apps-Android-Market.png" alt="Apps Android Market 10 useful sites to download Android Applications " title="Apps - Android Market" width="640" height="505" class="aligncenter size-full wp-image-5364" /></p>
<h3>Getjar</h3>
<p> Getjar is also considered to be the world’s largest free app store. Till date it boasts for about 2 billion downloads. <a href="http://www.getjar.com/">http://www.getjar.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/GetJar-Appsolutely-Everything-for-Nokia-BlackBerry-Android-Samsung-Sony-Ericsson-LG-Palm.png" alt="GetJar Appsolutely Everything for Nokia BlackBerry Android Samsung Sony Ericsson LG Palm 10 useful sites to download Android Applications " title="GetJar - Appsolutely Everything for Nokia, BlackBerry, Android, Samsung, Sony Ericsson, LG, Palm" width="640"  class="aligncenter size-full wp-image-5366" /></p>
<h3>Open Appmkt</h3>
<p> For all kinds of HTML 5apps, this is an online android apps download store. This web store gives open access to many android applications. <a href="http://openappmkt.com/">http://openappmkt.com/</a><img src="http://cdn.techprone.com/wp-content/uploads/2011/09/OpenAppMkt.png" alt="OpenAppMkt 10 useful sites to download Android Applications " title="OpenAppMkt" width="640"  class="aligncenter size-full wp-image-5367" /></p>
<p>Stay in tune with world and get best apps downloaded from these sites, which are the most truly wanted websites in today’s time.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/10-sites-download-android-applications/5185/feed</wfw:commentRss>
		<slash:comments>4</slash:comments>
		</item>
		<item>
		<title>Samsung Galaxy Tab 10.1 vs. Sony Tablet S: Which one will you choose?</title>
		<link>http://www.techprone.com/samsung-galaxy-tab-10-1-vs-sony-tablet-s-which-one-will-you-choose/5092</link>
		<comments>http://www.techprone.com/samsung-galaxy-tab-10-1-vs-sony-tablet-s-which-one-will-you-choose/5092#comments</comments>
		<pubDate>Mon, 19 Sep 2011 12:26:28 +0000</pubDate>
		<dc:creator>shaw</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Gadgets]]></category>
		<category><![CDATA[Mobile]]></category>
		<category><![CDATA[Samsung]]></category>
		<category><![CDATA[Sony]]></category>
		<category><![CDATA[Tech]]></category>
		<category><![CDATA[Samsung Galaxy Tab]]></category>
		<category><![CDATA[Samsung Galaxy Tab 10.1]]></category>
		<category><![CDATA[Samsung Galaxy Tab 750]]></category>
		<category><![CDATA[Sony Tablet]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=5092</guid>
		<description><![CDATA[Sony and Samsung both have reasons to be confident as they have priced the product exactly same as the Apple iPad. Both the companies offer most beautifully designed tablets to its consumers. Both of them are having unique and different features. Samsung came long back with its Galaxy Tab 10.1 which has been reigning market [...]]]></description>
			<content:encoded><![CDATA[<p></p><p style="text-align: left">Sony and Samsung both have reasons to be confident as they have priced the product exactly same as the Apple iPad. Both the companies offer most beautifully designed tablets to its consumers. Both of them are having unique and different features. Samsung came long back with its Galaxy Tab 10.1 which has been reigning market for long time. Let us see the present ruler with the new kid Sony Tablet S expected to be arriving in market soon.</p>
<p style="text-align: left">
<p style="text-align: center"><img class="size-full wp-image-5093 aligncenter" src="http://cdn.techprone.com/wp-content/uploads/2011/09/PF_sam10sonys-720_512x288.jpg" alt="PF sam10sonys 720 512x288 Samsung Galaxy Tab 10.1 vs. Sony Tablet S: Which one will you choose?" width="640" title="Samsung Galaxy Tab 10.1 vs. Sony Tablet S: Which one will you choose?" /></p>
<p><strong>Specifications comparison</strong>: Samsung Galaxy tab 10.1 is lighter, thinner and most stylish gadget in android that is available. It is only 8.6 mm with 0.2 mm thinner than the iPad. It has 10.1 inch touch screen with resolution of 1280*800 pixels. It comes with 3 mega pixel camera with 1080 HD video playback. Galaxy Tab 10.1 has 1 GHz Tegra 2 processor with 1 GB of RAM. On the other hand, Sony Tablet S has wrap design and it is very comfortable to hold. Exact dimensions of Sony Tablet S are not available. Sony tablet S gives 9.4 inch touch screen with 1280*800 pixels resolution. This comes with 2 cameras one in front and other in back. Sony Tablet S also features Tegra 2 processor but configuration of RAM is not available.</p>
<p><strong>Similar specifications</strong>: Both Samsung Galaxy Tab 10.1 as well as Sony Tablet S comes with Honeycomb OS. Samsung Galaxy Tab 10.1 uses latest Honeycomb 3.1 version while information is not available for version used in Sony Tablet S. Both of them feature Bluetooth, WI-Fi, DLNA connectivity options.</p>
<p><strong>Pricing</strong>:  Galaxy Tab 10.1 Is already being sold at $499 and Sony Tablet S is expected to be priced between $499-$599.</p>
<p><strong>Summary</strong>: Although not much finer details are available about Sony Tablet S, but from what is known it is surely going to be a great slate. But till now, Samsung Galaxy Tab 10.1 is the best choice as it is super thing, stylish and offers best, latest and newest features.</p>
<p><strong>Editor’s Rating</strong>: Without any flaws, Samsung Galaxy 10.1 is scoring 4.5 out of 5 stars. Sony tablet S has not been released but looking the different features and amazing looks, it is given 5 stars.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/samsung-galaxy-tab-10-1-vs-sony-tablet-s-which-one-will-you-choose/5092/feed</wfw:commentRss>
		<slash:comments>1</slash:comments>
		</item>
		<item>
		<title>List of 25 Best International Deals Sites</title>
		<link>http://www.techprone.com/list-of-25-best-international-deals-sites/2292</link>
		<comments>http://www.techprone.com/list-of-25-best-international-deals-sites/2292#comments</comments>
		<pubDate>Thu, 13 Jan 2011 12:43:11 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Top 10]]></category>
		<category><![CDATA[best deals sites]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=2292</guid>
		<description><![CDATA[Online business is expanding, due to several combined factors. One is that consumers today are not afraid of shopping online. On the other hand, we have major technology support of recommendation, social media that help to shop better. With online shopping first thing that comes to user is “comfort”, which is slowly increasing the number [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Online business is expanding, due to several combined factors. One is that consumers today are not afraid of shopping online. On the other hand, we have major technology support of recommendation, social media that help to shop better. With online shopping first thing that comes to user is “comfort”, which is slowly increasing the number of shoppers. Next users find best deals online that they might not get over the counter. So here is the list of 25 best international deals sites that are worth trying:</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2011/01/International-deals-sites.jpg"><img class="aligncenter size-full wp-image-2293" title="International deals sites" src="http://cdn.techprone.com/wp-content/uploads/2011/01/International-deals-sites.jpg" alt="International deals sites List of 25 Best International Deals Sites" width="550" height="366" /></a></p>
<ol>
<li><strong><a href="http://www.smartbargains.com/">Smartbargains </a></strong><strong>: </strong>SmartBargains is a concept      of bargain shopping where brands are available at discounted rate. It is a      division of Retail Convergence, Inc., a portfolio of e-commerce companies      based in Boston.</li>
<li><a href="www.ebay.com/"><strong>eBay</strong> </a>: eBay.com, like eBay.in is      an online auction and shopping website in which people and businesses buy      and sell a broad variety of goods and services. This site caters to the      international market, as opposed to its counterpart eBay.in that caters      primarily to the India market.</li>
<li><a href="http://www.bestbuy.com/site/index.jsp"><strong>BestBuy</strong> </a>:      BestBuy is a specialty retailer of consumer electronics in the United      States. It also operates in countries like Mexico, Canada, China, Turkey      and the United Kingdom. It focuses primarily on electronic goods and deals      available on them.</li>
<li><a href="http://www.dealsofamerica.com"><strong>DealsOfAmerica</strong> </a>:      DealsOfAmerica.com is one of the most frequently updated sites on the web.      The site is updated multiple times every hour -from early morning to late      evening. This site deals mostly with electroning stuffs like, Laptop, TV,      Mobiles etc.</li>
<li><strong><a href="http://www.mycoupons.com/">Mycoupon</a></strong><strong>:</strong> MyCoupon is considered one of      the world&#8217;s largest and oldest online source for coupons, coupon codes,      printable coupons, and coupon related social networking. It finds the best      coupons and coupon codes on the internet to save user’s time searching for      the coupon or code. It provides coupons and codes for a range of products.</li>
<li><a href="http://www.deals2buy.com"><strong>Deals2Buy</strong> </a>:      Deals2Buy is a shopping guide on where products are available, where the      best deals are available, which deals might work for a specific customer.      It is a free service that focuses on electronic deals.</li>
<li><a href="http://www.fatwallet.com/"><strong>FatWallet</strong> </a>:      FatWallet is a bargain hunting website. It focuses on a set of forums that      allow users to publish deals and rebate offers on a comprehensive range of      products and services. It is a site that provides bargains on a range of      products from beauty products to electronic gadgets.</li>
<li><strong><a href="http://www.bestdeal.com/">BestDeal</a></strong> :      BestDeals is powered by Price.com (an online price comparison site that      empowers buyers through reducing the inefficiencies of locating products      on the Internet). BestDeal provides the best deals in a whole range of      electronic products and travel information. It also gives its users access      to coupons and codes.</li>
<li><strong><a href="http://www.redflagdeals.com/">RedFlagDeals</a></strong> :      RedFlagDeals provide deals and offers available in Canada. This site      provides deals on all rages of products. It provides details about      coupons, lets users compare prices, details about freebees, daily deals,      sales and much more.</li>
<li><a href="http://dealnews.com/"><strong>Dealnews</strong> </a>:      Dealnews provides details of the best deals available on the hottest items      on the Internet. The site provides the best 100+ deals each and every day.      The site features deals and offers on a range of products. Additionally,      it provides coupon information, and the editor’s favourite deals.</li>
<li><strong><a href="http://www.hotukdeals.com/">HotUKDeal</a></strong> :      HotUKDeal (HUKD) is a community for deal seekers. This website is a UK      specific website that is interactive for members. It provides a forum for      people to find and share the best deals, promotional codes and vouchers on      the web.</li>
<li><strong><a href="http://deals.woot.com/">DealsWoot</a></strong> :      Deals Woot, like Hot UK Deals, is an interactive website where members can      find and share the best deals. However, Deals Woot is primarily for the      American audience.  The site gets      updated very often to provide users up to date information on deals and      offers.</li>
<li><a href="http://slickdeals.net/"><strong>Slickdeals</strong> </a>:      Slickdeals is a free, user-driven deal sharing site to provide users a      platform to collaborate and share information to make the best shopping      decisions. Slickdeals provides its users a forum for communication. The      site also provides users various shopping tools to make better choices.</li>
<li><strong><a href="http://www.pricewatch.com/">Pricewatch</a> :</strong> :      Pricewatch allows users to find the lowest price on all the most      popular products. Pricewatch provides users deals and offers on everything      ranging from music to clothes. This online store also offers computers,      music software, music recorders, electronic equipment and video      accessories.</li>
<li><strong><a href="http://bensbargains.net/">BensBargains</a></strong> :      For nearly a decade Ben’s Bargains has been posting discount codes daily      for electronics from various online retailers. It is a website that      gathers information about bargains from various online stores all in one      place and it is updated multiple times a day.</li>
<li><strong><a href="http://www.bestebazaar.com">Bestebazaar</a></strong> :      Bestebazaar offers a scratch auction platform for sellers to sell      their products. Buyers can scratch to see the current price with each      scratch the auction the item price is lowered. The member has a fixed      amount of time to choose to buy the product.</li>
<li><a href="http://www.edealinfo.com"><strong>eDealInfo</strong> </a><strong>:</strong> eDealInfo provides information      on deals, coupons, and vouchers on different products. It also follows      particular brands and provide discount. It is a combination of every day      deals and one day deals (that last only for the particular day). This site      is active in Canada, UK and US.</li>
<li><a href="www.dealcatcher.com/"><strong>DealCatcher</strong> </a>:      DealCatcher is an online website that offers coupons, coupon codes,      promotions and discounts for hundreds of online merchants. The site is      updated throughout the day to provide users with the best deals online. It      also has forums to discussion hot deals, freebies, sweepstakes, contests,      issues and grocery coupons.</li>
<li><a href="www.cheapstingybargains.com"><strong>Cheapstingybargains</strong> </a><strong>: </strong>Cheapstingybargains is an      online community that lists coupons and deals. It provides deals perusing sales,      close-outs, clearances, rebates, and exclusive coupons not generally      offered to visitors of the vendor’s sites. The website collects the      information from the internet, and updates every hour.</li>
<li><a href="http://gottadeal.com/"><strong>Gottadeal</strong> </a><strong>:</strong> The site provides deals and      coupons from different online and offline retailers. Additionally, the      site also has forums where more deals can be found. The forum has      dedicated message boards for topics like contests &amp; sweepstakes,      grocery coupons, freebies, surveys, finance, technology and more.</li>
<li><a href="http://www.roosster.com/nr/"><strong>Rosster</strong> </a><strong>: </strong>Rosster is a fairly new deals      website that provides information on deals and offers. This website      provides updates on deals across a whole range of products from kitchen to      electronics to jewellery.<br />
<strong> </strong></li>
<li><a href="http://www.dealsea.com"><strong>Dealsea</strong> </a><strong>:</strong> dealsea is one of the top 50000 sites in the world. Dealsea is      geared towards bargain hunters and deal shoppers. The site provides      merchant ratings. It also has a section exclusively to find coupons      available, at the moment .A rebate center that provides with rebate      status, and contact information is also available in the website.</li>
<li><a href="http://www.dealslist.com"><strong>Dealslist</strong> </a><strong>:</strong> Dealslist is an online      resource for shoppers that directly targets sales, discounts, and      promotions for hundreds of the top online merchants. Their goal is to be      the premier portal, internet bargain hunter, help users find and take      advantage of the best internet deals.</li>
<li><a href="http://www.dealmac.com"><strong>Dealmac</strong> </a><strong>: </strong>Dealmac is a deal site that is      provides best deals of Macintosh products. The website displays deals      available for a range of products including, Apple iPods, MacBooks,      desktops and others.</li>
<li><strong><a href="http://www.gotapex.com">Gotapex </a>: </strong>Gotapex is a site, quite      simply, dedicated to performance. The site focuses on hardware and software      reviews, has tutorials for over clocking and optimizing, provide the      latest news. More importantly, also provides updates on the hottest deals      available in the market.</li>
</ol>
<p>These are some of the sites that have gained popularity in couple of years. They are by no means listed in order nor are they the top providers, yet worth giving a try, so which is your favourite deal site? Let us know!</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/list-of-25-best-international-deals-sites/2292/feed</wfw:commentRss>
		<slash:comments>9</slash:comments>
		</item>
		<item>
		<title>10 Best Facebook Applications</title>
		<link>http://www.techprone.com/10-best-facebook-applications/2188</link>
		<comments>http://www.techprone.com/10-best-facebook-applications/2188#comments</comments>
		<pubDate>Wed, 29 Dec 2010 16:00:14 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[application]]></category>
		<category><![CDATA[Best]]></category>
		<category><![CDATA[Facebook]]></category>
		<category><![CDATA[social media]]></category>
		<category><![CDATA[Top 10]]></category>
		<category><![CDATA[Uncategorized]]></category>
		<category><![CDATA[applications]]></category>
		<category><![CDATA[facebook]]></category>
		<category><![CDATA[facebook applications]]></category>
		<category><![CDATA[top 10]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=2188</guid>
		<description><![CDATA[There is no ifs and buts about how more and more people are getting involved in Facebook. They carry out lot of activities like sharing status, posting photos and using Facebook applications. These facebook apps intend to entertain and help people using this social media. You will come across various app and some of them [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>There is no ifs and buts about how more and more people are getting involved in Facebook. They carry out lot of activities like sharing status, posting photos and using Facebook applications. These facebook apps intend to entertain and help people using this social media. You will come across various app and some of them are best of all. So here is the list of some best applications that been added that are used by different people based on their interests:</p>
<ol>
<li><strong><a href="http://www.facebook.com/search.php?q=6.%09Static%20FBML%20&amp;init=quick&amp;tas=0.0915199818219225&amp;ref=ts#!/FarmVille">Farmville </a></strong><strong>:</strong> Farmville is one of the most popular games on Facebook. Different Facebook users can play with their friends, acquire farm land, do farming, own a ranch and so on. Over 26.2 million people like the game and over 57.3 million people are monthly active users.<img class="aligncenter size-full wp-image-2207" title="FarmVille" src="http://cdn.techprone.com/wp-content/uploads/2010/12/FarmVille.png" alt="FarmVille 10 Best Facebook Applications" width="500" height="293" /></li>
<li><a href="http://www.facebook.com/search.php?q=6.%09Static%20FBML%20&amp;init=quick&amp;tas=0.0915199818219225&amp;ref=ts#!/iphone"><strong>Facebook for iPhone</strong> </a><strong>:</strong> Facebook for iPhone is just what its name suggests. It is an application that enables you to access Facebook on your iPhone. Over 1.75 million people like the application and over 57.8 million people are monthly active users.<img class="aligncenter size-full wp-image-2208" title="Facebook for iPhone" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Facebook-for-iPhone.png" alt="Facebook for iPhone 10 Best Facebook Applications" width="502" height="283" /></li>
<li><strong><a href="http://www.facebook.com/iLike">ilike </a></strong><strong>:</strong> iLike is an application that lets you add music, playlists, and videos to your profile. It also lets you dedicate songs to your friends, and see which of your friends is going to what concerts. Over 1.17 million people like the application and over 1.7 million people are monthly active users.<img class="aligncenter size-full wp-image-2209" title="iLike" src="http://cdn.techprone.com/wp-content/uploads/2010/12/iLike.png" alt="iLike 10 Best Facebook Applications" width="500" height="268" /></li>
<li><a href="http://www.facebook.com/flixster"><strong>Flixter</strong> </a><strong>: </strong>This application allows you to rate movies, take quizzes online, and compare movie tastes. It can also be used to get latest information on what’s new and good in the movies. Over 1.5 million people like the application and over 867 thousand people are monthly active users.<img class="aligncenter size-full wp-image-2210" title="Flixster" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Flixster.png" alt="Flixster 10 Best Facebook Applications" width="500" height="314" /></li>
<li><strong><a href="http://www.facebook.com/profile.php?id=100000168415859#!/apps/application.php?id=74769995908">Facebook For Android </a></strong><strong>: </strong>Facebook for Android(tm) helps you share information and stay connected using Facebook on your Android phone. Over 611 thousand people like the application, and more that 1.13 million people are active on a monthly bases.<img class="aligncenter size-full wp-image-2211" title="Facebook for Android" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Facebook-for-Android.png" alt="Facebook for Android 10 Best Facebook Applications" width="500" height="265" /></li>
<li><a href="http://www.facebook.com/apps/application.php?id=4949752878"><strong>Static FBML</strong> </a><strong>:</strong> Static FBML helps you design and change the look and feel of your Facebook. Additionally, you can use it to add advanced features and functions to your fan pages. Over 606 thousand people like the application and over 91.9 million people are monthly active users.<img class="aligncenter size-full wp-image-2212" title="static FBML" src="http://cdn.techprone.com/wp-content/uploads/2010/12/static-FBML.png" alt="static FBML 10 Best Facebook Applications" width="500" height="284" /></li>
<li><a href="http://www.facebook.com/flixster#!/BirthdayCal"><strong>Birthday Calendar</strong> </a><strong>:</strong> The birthday calendar helps you track all your friends’ birthdays. The application sends you reminders and email alerts to let you know when a friend’s birthday is coming up. Over 563 thousand people like the application and over 4.8 million people are monthly active users.<img class="aligncenter size-full wp-image-2213" title="Birthday Calendar" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Birthday-Calendar.png" alt="Birthday Calendar 10 Best Facebook Applications" width="501" height="274" /></li>
<li><a href="http://www.facebook.com/causes"><strong>Causes</strong> </a><strong>:</strong> If you believe in a cause or are part of a non-profit organization the <a href="http://apps.facebook.com/causes/?m=ed6ae9f3&amp;ref=ts">Cause application</a> helps you promote your vision and seek support. The application supports a number of causes ranging from animals to environment to religion. Over 321 thousand people like the application and over 22.9 million people are monthly <a href="http://apps.facebook.com/causes/?m=ed6ae9f3&amp;ref=ts">active</a> users.<img class="aligncenter size-full wp-image-2214" title="Causes" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Causes.png" alt="Causes 10 Best Facebook Applications" width="500" height="287" /></li>
<li><a href="http://www.facebook.com/apps/application.php?id=2339854854&amp;b"><strong>Horoscope</strong> </a><strong>:</strong> Horoscope as the name suggests gives you updates on your horoscope. Over 222 thousand people like the application and over 409 thousand people are monthly active users.<img class="aligncenter size-full wp-image-2215" title="Horoscopes" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Horoscopes.png" alt="Horoscopes 10 Best Facebook Applications" width="500" height="280" />10. <strong><a href="http://apps.facebook.com/apps/application.php?id=2383452981&amp;b">Call me on Skype </a></strong><strong>:</strong> If connectivity is your forte, it doesn’t get easier than Skype. Integrating Skype to Facebook can be the most effective ways to integrate your entire scope of communication. Skype is free and when integrated with Facebook enables you to make and receive calls from Facebook. Over 73 thousand people like the application, and more that 31 thousand people are active on a monthly bases.
<p><img class="aligncenter size-full wp-image-2216" title="Skype_me" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Skype_me.png" alt="Skype me 10 Best Facebook Applications" width="500" height="269" /></li>
</ol>
<p><strong>Bonus </strong></p>
<p><a href="http://apps.facebook.com/marketplace/?cm_mmc_o=PBBLFzyLCjC_BBLFzyLCjC_BBLFzyLCjCtBFw&amp;ref=ts"><strong>Marketplace</strong> </a><strong>:</strong>The Marketplace is a application that allows sellers and buyers to interact. It is the digital agora to sell, buy, and bargain for products.</p>
<p><img class="aligncenter size-full wp-image-2217" title="Marketplace" src="http://cdn.techprone.com/wp-content/uploads/2010/12/Marketplace.png" alt="Marketplace 10 Best Facebook Applications" width="495" height="300" /></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/10-best-facebook-applications/2188/feed</wfw:commentRss>
		<slash:comments>12</slash:comments>
		</item>
		<item>
		<title>10 Best Halloween Costumes and Trends</title>
		<link>http://www.techprone.com/latest-halloween-costumes-and-trends-of-2010/1805</link>
		<comments>http://www.techprone.com/latest-halloween-costumes-and-trends-of-2010/1805#comments</comments>
		<pubDate>Wed, 27 Oct 2010 04:27:41 +0000</pubDate>
		<dc:creator>Nikita Porwal</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[Top 10]]></category>
		<category><![CDATA[Halloween Costumes]]></category>
		<category><![CDATA[top 10]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1805</guid>
		<description><![CDATA[Halloween is nearing, so what’s the plan? Yes, as the year turns we come across some awesome festivals that bring us joy and happiness. And Halloween is one of those festivals that is not only celebrated in US, but all across the world. Halloween is an annual holiday observed on October 31. It has roots [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>Halloween is nearing, so what’s the plan? Yes, as the year turns we come across some awesome festivals that bring us joy and happiness. And Halloween is one of those festivals that is not only celebrated in US, but all across the world. Halloween is an annual holiday observed on October 31. It has roots in the Celtic festival of Samhain and the Christian holiday All Saints&#8217; Day. The common activities on this day include trick-or-treating, wearing costumes, carving jack-o&#8217;-lanterns, ghost tours, bonfires, apple bobbing, visiting haunted attractions, committing pranks, watching horror films and so on. Halloween costumes were traditionally modelled after monsters such as ghosts, skeletons, witches, and devils. Over time, the costume selection extended to include popular characters from fiction, celebrities, and generic archetypes such as ninjas and princesses. Every year, new costumes are introduced to indicate some of the important things that year. Here are the top 10 latest Halloween Costumes of 2010, some classic favourites.</p>
<p><strong>1. Lady Gaga:</strong> Gaga, the recently popularized singer, donned the creation on the red carpet at MTV’s Video Music Awards 2010. This prompted debate and speculation about whether it really was made of meat. This year predictions are that Lady Gaga’s meat costume will be well received at the Halloween parties. Lady Gaga has her own site, ladygaga.com that sells official Gaga costumes, wigs and accessories.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/lady_gaga_meat_dress.jpg"><img class="aligncenter size-full wp-image-1806" title="lady_gaga_meat_dress" src="http://cdn.techprone.com/wp-content/uploads/2010/10/lady_gaga_meat_dress.jpg" alt="lady gaga meat dress 10 Best Halloween Costumes and Trends" width="199" height="300" /></a></p>
<p>2. <strong>Avatar Costumes:</strong> With the release of the movie Avatar, and its wide spread success, it is predicted that it will be in the running for one of the most popular costumes this Halloween season. The Avatar costume is predicted to be specifically popular with the ladies.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Avatar-Costumes.jpeg"><img class="aligncenter size-full wp-image-1807" title="Avatar Costumes" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Avatar-Costumes.jpeg" alt=" 10 Best Halloween Costumes and Trends" width="208" height="300" /></a></p>
<p>3. <strong>Paul the Octopus:</strong> Paul the Octopus got famous during the Football World Cup. Paul correctly predicted all games involving Germany, and also picked Spain to win the World Cup final over the Netherlands. With the popularity of Paul and reports of his death, will lead to a lot of popularity of Paul the Octopus costume.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Paul-the-Octopus.jpg"><img class="aligncenter size-full wp-image-1808" title="Paul the Octopus" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Paul-the-Octopus.jpg" alt="Paul the Octopus 10 Best Halloween Costumes and Trends" width="345" height="300" /></a></p>
<p>4. <strong>Cast of Jersey Shore:</strong> Jersey Shore is a reality show that follows eight brash, party-loving residents of Seaside Height and the Snooki and Pauly D are its biggest star. The popularity of this show and the star has increased the chances of becoming a popular Halloween costume.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/jersey-shore.jpg"><img class="aligncenter size-full wp-image-1809" title="jersey-shore" src="http://cdn.techprone.com/wp-content/uploads/2010/10/jersey-shore.jpg" alt="jersey shore 10 Best Halloween Costumes and Trends" width="250" height="300" /></a></p>
<p>5. <strong>Alice in Wonderland:</strong> Characters in Alice in Wonderland have been popular amongst adults, teens, and kids alike. These costumes are also popular among option to provide costumes for pets. This has specifically increased in popularity after the release this year of Tim Burton&#8217;s re-telling of the tale.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Alice-in-Wonderland.jpg"><img class="aligncenter size-full wp-image-1810" title="Alice-in-Wonderland" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Alice-in-Wonderland.jpg" alt="Alice in Wonderland 10 Best Halloween Costumes and Trends" width="300" height="300" /></a></p>
<p>6. <strong>Star Wars:</strong> Since the first release of Star Wars, it has been popular around Halloween seasons for the costumes that can be based on it. For years this has been a popular costume for Halloween, and will maintain the demand for costumes even this year especially for pets.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Star-Wars.jpg"><img class="aligncenter size-full wp-image-1811" title="Star Wars" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Star-Wars.jpg" alt="Star Wars 10 Best Halloween Costumes and Trends" width="260" height="300" /></a></p>
<p>7. <strong>Shrek costumes:</strong> Shrek is an animation film that has had many series and is popular among kids and adults alike. The protagonist, Shrek, and his wife Fiona have been a favourite amongst costumes around Halloween, since the movie’s first movie release in 2001. The latest release of Shrek in 2010, ‘Shrek Forever After’ has just brought its costumes back to the front as a popular costume option this Halloween.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Shrek-costumes.jpg"><img class="aligncenter size-full wp-image-1812" title="Shrek costumes" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Shrek-costumes.jpg" alt="Shrek costumes 10 Best Halloween Costumes and Trends" width="157" height="300" /></a></p>
<p>8. <strong>Iron Man:</strong> This year saw the release of Iron Man 2. This has brought Iron Man costumes right back in focus and popular. With the success of Iron Man 2 has the costume promises to be a very popular option this Halloween (2010). The popularity of Marvel comic trends has superhero costumes and gear at.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Iron-Man.jpg"><img class="aligncenter size-full wp-image-1813" title="Iron Man" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Iron-Man.jpg" alt="Iron Man 10 Best Halloween Costumes and Trends" width="205" height="300" /></a></p>
<p>9. <strong>Buzz Lightyear:</strong> Buzz Lightyear of Toy Story fame, is again one of the top choices for a Halloween costume. The third instalment of it was released amid almost universal acclaim earlier this year. &#8220;Toy Story 3&#8243; has made the character a popular costume again.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/Buzz-Lightyear.jpg"><img class="aligncenter size-full wp-image-1814" title="Buzz Lightyear" src="http://cdn.techprone.com/wp-content/uploads/2010/10/Buzz-Lightyear.jpg" alt="Buzz Lightyear 10 Best Halloween Costumes and Trends" width="212" height="300" /></a></p>
<p>10. <strong>Evergreen costumes:</strong> Despite all the new entrants and famous costumes, there are some costumes that almost never go out of style. Some of the costumes are vampires, pirates, doctors, police officers, clowns, princesses, witches, pumpkins, Batman, Cat Woman, Superman, Spiderman, Batman and Robin, ninjas, bees, and angels.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2010/10/evergreen-costumes.jpg"><img class="aligncenter size-full wp-image-1815" title="evergreen costumes" src="http://cdn.techprone.com/wp-content/uploads/2010/10/evergreen-costumes.jpg" alt="evergreen costumes 10 Best Halloween Costumes and Trends" width="400" height="300" /></a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/latest-halloween-costumes-and-trends-of-2010/1805/feed</wfw:commentRss>
		<slash:comments>6</slash:comments>
		</item>
		<item>
		<title>How to choose the best images for the blog posts using Flickr</title>
		<link>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276</link>
		<comments>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276#comments</comments>
		<pubDate>Mon, 06 Jul 2009 10:38:43 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Flickr]]></category>
		<category><![CDATA[free]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[blog]]></category>
		<category><![CDATA[bloggers]]></category>
		<category><![CDATA[blogging]]></category>
		<category><![CDATA[image editing]]></category>
		<category><![CDATA[image flickr]]></category>
		<category><![CDATA[Images]]></category>
		<category><![CDATA[plugin]]></category>
		<category><![CDATA[wordpress]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=1276</guid>
		<description><![CDATA[As we all know that “content is the king” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only. Power of Images: If i described in more [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>As we all know that “<strong><em>content is the king</em></strong>” but their are few other things that can boost the presentations of your blog pots. About 80-90% of internet mass is very fluctuating and scans the internet on the basis of keyword and stay for interesting images only.</p>
<p><strong>Power of Images: </strong>If i described in more brief than have an example of comic books where we read the images together with the bubble texts. Have you ever read any comic book in unknown language? May be yes, I think you can go through the whole story of the comics without having the raw knowledge of that language, this is the power of images.</p>
<p>Using relevant and customized images in the blogpost always helps users to understand your points. Their are many ways to choose the images from the websites like <a href="http://flickr.com">flickr</a> , <a href="http://images.google.com">google images</a> and other. Note: You may also use the advance powers of the flickr images search.</p>
<p><img style="border-bottom: 0px; border-left: 0px; margin: 0px auto 10px; display: block; float: none; border-top: 0px; border-right: 0px" title="flickr-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearch1.png" border="0" alt="flickrsearch1 How to choose the best images for the blog posts using Flickr" width="467" height="39" /> Options to search creative and legal images out of the <a href="http://www.flickr.com/search/?q=&amp;w=all">flickr search</a>:</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvance1.png" border="0" alt="flickrsearchadvance1 How to choose the best images for the blog posts using Flickr" width="584" height="95" /></p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearch1.png" border="0" alt="flickrsearchadvancesearch1 How to choose the best images for the blog posts using Flickr" width="582" height="153" /></p>
<p>1.<strong>Creative Commons </strong>licensed Images</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-cc-licensed" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcclicensed1.png" border="0" alt="flickrsearchadvancesearchcclicensed1 How to choose the best images for the blog posts using Flickr" width="559" height="119" /></p>
<p>2.<strong>Search by content type</strong> have the options to have creative, innovative ,artistic images. Here you can also get the Screenshots and Screencasts for your blogposts.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-content" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchcontent2.png" border="0" alt="flickrsearchadvancesearchcontent2 How to choose the best images for the blog posts using Flickr" width="564" height="150" /></p>
<p>3.<strong>SafeSearch </strong>options</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-safe" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchsafe1.png" border="0" alt="flickrsearchadvancesearchsafe1 How to choose the best images for the blog posts using Flickr" width="532" height="124" /></p>
<p>4.<strong>Search Photos , Videos or both media types</strong>.</p>
<p><img style="border-bottom: 0px; border-left: 0px; display: inline; border-top: 0px; border-right: 0px" title="flickr-search-advance-search-media-type" src="http://cdn.techprone.com/wp-content/uploads/2009/07/flickrsearchadvancesearchmediatype1.png" border="0" alt="flickrsearchadvancesearchmediatype1 How to choose the best images for the blog posts using Flickr" width="528" height="150" /></p>
<p>Apart from these manual ways their are several plugins to automatically including images in the wordpress editor. Few of the plugins are <a href="http://wordpress.org/extend/plugins/flickr-post/">Flickr Post</a> , <a href="http://wordpress.org/extend/plugins/wordpress-flickr-manager-1/">WordPress Flickr Manager</a> , <a href="http://wordpress.org/extend/plugins/wp-flickr/">WP-Flickr</a> ,<a href="http://wordpress.org/extend/plugins/pflickr/">Photo of the Day &#8211; flickr widget</a> ,<a href="http://wordpress.org/extend/plugins/scriblio-importer-flickr/">Scriblio flickr Importer</a> ,<a href="http://wordpress.org/extend/plugins/get-flickr-thumbnails/">Get Flickr Thumbnails</a> ,<a href="http://wordpress.org/extend/plugins/simple-flickr-plugin/">Simple Flickr Photos</a> ,<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/">Flickr Feed Gallery</a> and many more.<a href="http://wordpress.org/extend/plugins/flickr-feed-gallery/"><br />
</a></p>
<p><strong>Note </strong>: Wait for my upcoming posts on designing customized images for the blog posts. Few pots like “<a href="http://www.techprone.com/future-trends-of-mobile-networking/">Future Trends of Mobile Networking</a>” have light customization over flickr images. You need to note that by giving proper reference of the image source, you are enhancing your own credibility in front of your users. Few other pots like <a href="http://www.techprone.com/5-benefits-of-using-social-bookmarking/">5 benefits of using Social bookmarking</a> are the beautiful examples of designing fully customized images out of your own creativity. So be patience and soon i’ll cover up those easy posts of designing.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/how-to-choose-the-best-images-for-the-blog-posts-using-flickr/1276/feed</wfw:commentRss>
		<slash:comments>7</slash:comments>
		</item>
		<item>
		<title>15 best creativity of photos</title>
		<link>http://www.techprone.com/15-best-creativity-of-photos/793</link>
		<comments>http://www.techprone.com/15-best-creativity-of-photos/793#comments</comments>
		<pubDate>Sat, 23 May 2009 01:02:47 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[design]]></category>
		<category><![CDATA[creativity]]></category>
		<category><![CDATA[photo editing]]></category>
		<category><![CDATA[photographics technique]]></category>
		<category><![CDATA[photography]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=793</guid>
		<description><![CDATA[You might hear that Creativity is a type of learning process where the teacher and pupil are located in the same individual.Every one have its own gumption of seeing things and here are 15 best creative photos that reflects the series of questions in your mind and you will confused why and how this photo [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>You might hear that <em>Creativity is a type of learning process where the teacher and pupil are located in the same individual</em>.Every one have its own gumption of seeing things and here are 15 best creative photos that reflects the series of questions in your mind and you will confused why and how this photo come into existence.From the designs to the colors, direction to the stated expressions these photos have a unique story associated with it.Now find out which story affects you most.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/05/nightgirl.jpg"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="night-girl" src="http://cdn.techprone.com/wp-content/uploads/2009/05/nightgirl-thumb.jpg" border="0" alt="nightgirl thumb 15 best creativity of photos" width="586" height="332" /></a></p>
<p><a href="http://1x.com/photos/member/1490/15243/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="POISED" src="http://cdn.techprone.com/wp-content/uploads/2009/05/poised.jpg" border="0" alt="poised 15 best creativity of photos" width="585" height="378" /></a></p>
<p><a href="http://1x.com/photos/latest-additions/25064/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="I m not me" src="http://cdn.techprone.com/wp-content/uploads/2009/05/imnotme.jpg" border="0" alt="imnotme 15 best creativity of photos" width="583" height="414" /></a></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="w a l t" src="http://cdn.techprone.com/wp-content/uploads/2009/05/walt.jpg" border="0" alt="walt 15 best creativity of photos" width="581" height="447" /></p>
<p><a href="http://1x.com/photos/popular/week/25047/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Parotsnake" src="http://cdn.techprone.com/wp-content/uploads/2009/05/parotsnake.jpg" border="0" alt="parotsnake 15 best creativity of photos" width="582" height="395" /></a><br />
<span id="more-793"></span><br />
<a href="http://1x.com/photos/popular/week/24999/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Screamer" src="http://cdn.techprone.com/wp-content/uploads/2009/05/screamer.jpg" border="0" alt="screamer 15 best creativity of photos" width="581" height="399" /></a></p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/05/cupofsunshine.jpg"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Cup of Sunshine" src="http://cdn.techprone.com/wp-content/uploads/2009/05/cupofsunshine-thumb.jpg" border="0" alt="cupofsunshine thumb 15 best creativity of photos" width="579" height="524" /></a></p>
<p><a href="http://1x.com/v2/#photos/creative-edit/25040/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Manipulation" src="http://cdn.techprone.com/wp-content/uploads/2009/05/manipulation.jpg" border="0" alt="manipulation 15 best creativity of photos" width="577" height="392" /></a></p>
<p><a href="http://dontclickthis.whatingods.name/dino-at-home.jpg"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="dino-at-home" src="http://cdn.techprone.com/wp-content/uploads/2009/05/dinoathome.jpg" border="0" alt="dinoathome 15 best creativity of photos" width="583" height="442" /></a></p>
<p><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Pacu Jawi (Cow's Race)" src="http://cdn.techprone.com/wp-content/uploads/2009/05/pacujawicowsrace.jpg" border="0" alt="pacujawicowsrace 15 best creativity of photos" width="583" height="395" /></p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/05/aftertheend2.jpg"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="after the end .2" src="http://cdn.techprone.com/wp-content/uploads/2009/05/aftertheend2-thumb.jpg" border="0" alt="aftertheend2 thumb 15 best creativity of photos" width="581" height="581" /></a></p>
<p><a href="http://1x.com/v2/#photos/creative-edit/24513/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="outside the hospitalroom" src="http://cdn.techprone.com/wp-content/uploads/2009/05/outsidethehospitalroom.jpg" border="0" alt="outsidethehospitalroom 15 best creativity of photos" width="582" height="465" /></a></p>
<p><a href="http://1x.com/v2/#photos/popular/ever/18519/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Der Morgen Danach" src="http://cdn.techprone.com/wp-content/uploads/2009/05/dermorgendanach.jpg" border="0" alt="dermorgendanach 15 best creativity of photos" width="580" height="505" /></a></p>
<p><a href="http://1x.com/v2/#photos/creative-edit/13935/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="skin-deep" src="http://cdn.techprone.com/wp-content/uploads/2009/05/skindeep.jpg" border="0" alt="skindeep 15 best creativity of photos" width="581" height="394" /></a></p>
<p><a href="http://1x.com/v2/#photos/popular/ever/20211/"><img style="border-right-width: 0px; display: inline; border-top-width: 0px; border-bottom-width: 0px; border-left-width: 0px" title="Closing In" src="http://cdn.techprone.com/wp-content/uploads/2009/05/closingin.jpg" border="0" alt="closingin 15 best creativity of photos" width="578" height="802" /></a></p>
<p>If you have any questions or your minds wants to convey any queries regarding the above mentioned 15 nameless photography then feel free to share with us.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/15-best-creativity-of-photos/793/feed</wfw:commentRss>
		<slash:comments>8</slash:comments>
		</item>
		<item>
		<title>iPhone 3.0: Hits and misses</title>
		<link>http://www.techprone.com/iphone-30-hits-and-misses/628</link>
		<comments>http://www.techprone.com/iphone-30-hits-and-misses/628#comments</comments>
		<pubDate>Thu, 19 Mar 2009 07:31:43 +0000</pubDate>
		<dc:creator>harshit</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[Gadgets]]></category>
		<category><![CDATA[google]]></category>
		<category><![CDATA[iPhone]]></category>
		<category><![CDATA[seo]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[Apple]]></category>
		<category><![CDATA[applications]]></category>
		<category><![CDATA[gps]]></category>
		<category><![CDATA[hits and miss]]></category>
		<category><![CDATA[iPhone3.0]]></category>
		<category><![CDATA[Mobile]]></category>
		<category><![CDATA[music]]></category>
		<category><![CDATA[pda]]></category>
		<category><![CDATA[Tech]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=628</guid>
		<description><![CDATA[After the roaring success of iPhone 2.0 last year, Apple is back in action to widen its presence in the smartphone market. In a hotly-awaited event last night, Apple Inc unveiled the new operating system software, called iPhone OS 3.0. Other than adding new features, Apple has also made up for some of the big [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>After the roaring success of iPhone 2.0 last year, Apple is back in action to widen its presence in the smartphone market.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="text" href="http://www.flickr.com/photos/27676525@N08/3366598227/"><img class="pc_img aligncenter" src="http://farm4.static.flickr.com/3641/3366598227_341ceef839_m.jpg" alt="3366598227 341ceef839 m iPhone 3.0: Hits and misses" width="397" height="270" title="iPhone 3.0: Hits and misses" /></a></span></p>
<p>In a hotly-awaited event last night, Apple Inc unveiled the new operating system software, called iPhone OS 3.0. Other than adding new features, Apple has also made up for some of the big misses in the existing model.<br />
So, here&#8217;s over to the pluses and minuses of Apple iPhone 3.0 software.<br />
<span style="color: #993300;"><strong>Hits of iPhone3 .0</strong></span><br />
<span style="color: #0000ff;"><strong>Hit 1: Upgrade&#8217;s free </strong></span></p>
<p>iPhone users get the new software for free, while iPod Touch users will have to pay $9.95. The operating system runs on the latest version of the iPhone, released last year, as well as the original model.<br />
Apple currently has 25,000 applications in its online iPhone App Store. More than 800 million programmes have been downloaded since July, the company said.<br />
The company has distributed 800,000 iPhone software kits to developers, who write programmes for delivery though the App Store.<br />
<strong><span style="color: #0000ff;">Hit 2: Cut-copy-paste</span> </strong>Yes, cut-copy-paste is there now! The new software adds this one of the most sorely missed feature in the existing iPhone 2.0.<br />
Apple said the third generation of iPhone software will let users copy information from notes and Web pages, and let people move text between different applications. Users who erroneously paste text can shake the iPhone to get an option to cut it.<br />
<span style="color: #0000ff;"><strong>Hit 3: Multimedia messaging</strong></span></p>
<p>Another one from the iPhone wishlist, Apple offers multimedia messaging capability with the new 3.0 software allowing users to send each other photographs from the phone.<br />
Earlier, users could send text messages or snapshots via email only.<br />
<span id="more-628"></span> <span style="color: #0000ff;"><strong>Hit 4: Stereo Bluetooth</strong></span></p>
<p>Another big miss in the current version, Stereo Bluetooth, makes its entry. This means iPhone users will be able to listen to music through wireless headphones now.<br />
iPhone users can also link to other phones via Bluetooth and automatically be connected to wi-fi hotspots. The earlier version didn&#8217;t let iPhone sync with Bluetooth stereo or in-car Bluetooth handsfree. It lacked A2DP on Bluetooth. A2DP audio devices, such as stereo Bluetooth headsets, offer better quality audio.<br />
<strong>Hit 5: Text messaging </strong></p>
<p>Yes, this too has been added now! The new iPhone version offers text forwarding feature, another sorely missed feature in the previous version. Users will now be able to delete individual messages in a chat thread. Also, with the latest version users will be able to forward meeting invites and contacts.<br />
The earlier version didn&#8217;t let users forward a text message. Users could only send text messages or snapshots <strong>via email.<br />
<span style="color: #0000ff;">Hit 6: GPS</span></strong></p>
<p class="Photo"><span class="photo_container pc_m"><a title="gps" href="http://www.flickr.com/photos/27676525@N08/3366598229/"><br />
</a></span></p>
<p>The iPhone will now become a full-fledged GPS device with iPhone 3.0. The new upgrade will enable users to receive turn-by-turn instructions for driving similar to those in use on GPS navigation devices. The feature will be available through apps.<br />
<span style="color: #0000ff;"><strong>Hit 7: Shake to shuffle songs</strong></span></p>
<p>The new iPhone software comes with shake-to-shuffle-songs capability. The feature was first introduced in the revamped iPod Nano. Another addition is voice memo application; a function that will let the iPhone work with Bluetooth headphones and speakers &#8212; a boon for <strong>people who want more options to play music stored on their iPhones.<br />
<span style="color: #0000ff;">Hit 8: Landscape keyboard and Push notification</span></strong></p>
<p>Another big miss in iPhone 2.0, makes its presence with upgrade. Users will now be able to read and compose email and text messages in landscape mode.<br />
The next-generation iPhone operating system will enable so-called push notification, allowing developers to build applications that can provide automatic alerts of items such as sports results or the arrival of an instant message. The alerts would show up automatically even if the user is in another application.<br />
It will also allow developers to offer subscriptions and sell content within their applications that have items for sale within them, such as electronic books or additional levels of a video game. And developers will be able to access the music within users&#8217; iPhone libraries, so songs they own can be included in games, for example.<br />
<span style="color: #0000ff;"><strong>Hit 9: Search</strong></span></p>
<p>The company has unveiled a widely anticipated universal search feature called &#8220;spotlight,&#8221; which can scour key applications on the phone such as email and iPod.<br />
The feature will let users hunt for information in multiple applications at once, including notes, calendar and iTunes.<br />
<span style="color: #993300;"><strong>Miss of  iPhone 3.0</strong></span><br />
<span style="color: #0000ff;"><strong>Miss 1: Video recording</strong></span></p>
<p>There were speculations for video recording feature, however, Apple again disappointed. This is especially a dampener since video recording feature is today found in most cell phones, even those at the lower end.<br />
Also, most of Apple’s rivals in the cell phone space like Nokia, Sony Ericsson and Samsung are offering higher <span style="color: #0000ff;"><span style="color: #0000ff;">version cameras.</span><br />
<strong>Miss 2: Flash</strong></span></p>
<p>Apple dogged this topic by saying they had no announcements today. Earlier, Adobe said it is working on iPhone Flash, but sadly for now there is no support for Adobe Flash in the upcoming iPhone model.<br />
Currently, when users browse through Web pages with Adobe Flash it displays empty spaces with missing icons. Earlier Apple claimed that Flash would run too slowly on the iPhone.<br />
<span style="color: #0000ff;"><strong>Miss 3: Voice dialing</strong></span></p>
<p>The glaring miss in the latest upgrade is lack of voice dialing feature. It lacks support for voice-recognition to let users dial verbally.<br />
However, it is expected that voice memos and other audio recording will also be possible with the new software which will be officially released in summer.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/iphone-30-hits-and-misses/628/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>Reasons to go for PS3</title>
		<link>http://www.techprone.com/reasons-to-go-for-ps3/568</link>
		<comments>http://www.techprone.com/reasons-to-go-for-ps3/568#comments</comments>
		<pubDate>Tue, 10 Feb 2009 22:25:20 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[games]]></category>
		<category><![CDATA[Linux]]></category>
		<category><![CDATA[Tech]]></category>
		<category><![CDATA[Video]]></category>
		<category><![CDATA[wifi]]></category>
		<category><![CDATA[Blu-ray Disc]]></category>
		<category><![CDATA[playstation]]></category>
		<category><![CDATA[playstation 3]]></category>
		<category><![CDATA[PS3]]></category>
		<category><![CDATA[Reasons]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=568</guid>
		<description><![CDATA[The PlayStation 3 (PS3) is the brain child produced by Sony Computer Entertainment.PS3 is hottest gadget in the gaming market and have variety of eye candy features that makes it class from the other rivals in the gaming console.IT have racy multimedia capabilities, portable connectivity with the PlayStation , and its use of a high-definition [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>The PlayStation 3 (PS3) is the brain child produced by Sony Computer Entertainment.PS3 is hottest gadget in the gaming market and have variety of eye candy features that makes it class from the other rivals in the gaming console.IT have racy multimedia capabilities, portable connectivity with the PlayStation , and its use of a high-definition optical disc format, Blu-ray Disc, as its primary storage medium.More if you are still not satisfied the their are few more reasons to go for PS3, which are listed as follows:<img style="border-right: 0px; border-top: 0px; display: block; float: none; margin-left: auto; border-left: 0px; margin-right: auto; border-bottom: 0px" title="ps3" src="http://cdn.techprone.com/wp-content/uploads/2009/02/ps3.jpg" border="0" alt="ps3 Reasons to go for PS3" width="539" height="334" /></p>
<ul>
<li><strong>Use PS3 as a PC – </strong>You can easily install the other OS like Fedora Core 5, Yellow Dog Linux and Gentoo and can use it as a dedicated PC.So now your gaming devil can gratify your Pc needs.<span id="more-568"></span></li>
<li><strong>Use PS3 as media server – </strong>Most of us have the media files like music,video stored in the computers so in case we don’t want to shift to computer then our PS3 can do this.Yes, media files can be shared via players like windows media player and can be easily searched by PS3 via XMB.XMB acts as the gateway to streaming your media and can be detectable when your shared system is turned on.</li>
<li><strong>Multitasking features</strong>– You want to play games , want to play music during slideshows or browsing the Web need not to worry  <a href="http://www.gadgets4nowt.co.uk/">PS3</a> have the multitasking features.</li>
<li><strong>Graphical user interface</strong> – Play station have awesome user interface and navigation with option to manage various master and secondary user profiles.Do you know the elegant design featuring clean lines and pleasing curves makes it class apart.Moreover it have resolutions    of 480i, 480p, 720p, 1080i, 1080p</li>
<li><strong>Mobility of Wireless technology</strong> – PS3 have built-in 802.11 b/g Wi-Fi that makes it class apart gamming console.</li>
<li><strong>Blu-ray optical-disc –</strong> PS3 have the Blu-ray optical-disc drive which are capable of  playing games and movie discs.Do you know each Blu-ray disc can hold up to 54GB worth of data, which should virtually assure the no need of extra space for the game.</li>
</ul>
<p>Note: Are you interested in getting  <a href="http://www.gadgets4nowt.co.uk/">free PS3</a> ?</p>
<p>Comments and suggestions are invited.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/reasons-to-go-for-ps3/568/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>Uncovered things about your web hosting</title>
		<link>http://www.techprone.com/uncovered-things-about-your-web-hosting/539</link>
		<comments>http://www.techprone.com/uncovered-things-about-your-web-hosting/539#comments</comments>
		<pubDate>Sun, 08 Feb 2009 14:14:40 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[business]]></category>
		<category><![CDATA[develpoment]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[productivity]]></category>
		<category><![CDATA[Tech]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[Tools]]></category>
		<category><![CDATA[bandwidth]]></category>
		<category><![CDATA[cpu limit]]></category>
		<category><![CDATA[dns function]]></category>
		<category><![CDATA[mysql]]></category>
		<category><![CDATA[process]]></category>
		<category><![CDATA[things]]></category>
		<category><![CDATA[Uncovered]]></category>
		<category><![CDATA[web hosting]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=539</guid>
		<description><![CDATA[The traditional factors that common users looks before buying  the web servers and web hosts are the amount of SPACE they are providing and the associated BANDWIDTH with it.If you are also one of those who gives the more priority to SPACE – BANDWIDTH rather than server structure and health then your are fooling around [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>The traditional factors that common users looks before buying  the web servers and web hosts are the amount of <strong>SPACE</strong> they are providing and the associated <strong>BANDWIDTH</strong> with it.If you are also one of those who gives the more priority to SPACE – BANDWIDTH rather than server structure and health then your are fooling around yourself and committing some blunders. <strong>Do you know why?</strong> The answers is quite obvious that their are few factors which are more important than the space and bandwidth.Before deciding the <a href="http://www.mybestratedwebhosting.com/">best web hosting</a> you need to know about as follows classified factors :</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2009/02/hostcpu1.png"><img style="border-top-width: 0px; display: block; border-left-width: 0px; float: none; border-bottom-width: 0px; margin-left: auto; margin-right: auto; border-right-width: 0px" title="host-cpu1" src="http://cdn.techprone.com/wp-content/uploads/2009/02/hostcpu1-thumb.png" border="0" alt="hostcpu1 thumb Uncovered things about your web hosting" width="426" height="455" /></a></p>
<p><strong>1.No of Process </strong>- The number of processes being ran from your individual account. Processes usually start/stop <img class="alignleft size-full wp-image-543" title="process2" src="http://cdn.techprone.com/wp-content/uploads/2009/02/process2.png" alt="process2 Uncovered things about your web hosting" width="216" height="68" />immediately, but occasionally a script will encounter an error that will cause its process to hang or freeze. In case you are out of your process limit then you will face <strong>Internel Server Error</strong> – 500 .Commonly if you don’t have the dedicated servers then you your servers have the process limits in 20-30.</p>
<p><img style="border-top-width: 0px; display: block; border-left-width: 0px; float: none; border-bottom-width: 0px; margin-left: auto; margin-right: auto; border-right-width: 0px" title="process1" src="http://cdn.techprone.com/wp-content/uploads/2009/02/process1.png" border="0" alt="process1 Uncovered things about your web hosting" width="555" height="125" /><span id="more-539"></span></p>
<p><strong>2.DNS Functions -</strong> DNS Functions is classified as ability to change the domain name functions like <strong><a href="http://cdn.techprone.com/wp-content/uploads/2009/02/dnsfunction.png"><img style="border-top-width: 0px; display: inline; border-left-width: 0px; border-bottom-width: 0px; margin: 0px 15px 0px 0px; border-right-width: 0px" title="dns-function" src="http://cdn.techprone.com/wp-content/uploads/2009/02/dnsfunction-thumb.png" border="0" alt="dnsfunction thumb Uncovered things about your web hosting" width="217" height="168" align="left" /></a></strong><strong>MX Entry</strong> , <strong>CNAME records, DNAME records,NS entry,Domain alias</strong> etc.</p>
<p>Generally most of the shared hosting lacks the all of the dns functions and in case you have to edit them then you have to drop a mail to the support teams.</p>
<p>Example:</p>
<p>1.when you need to activate google apps or while activating mail accounts you need to change the MX entries and CNAME entries.</p>
<p>2.When you are activating feed burner account on your subdomain i.e feed.yoursite.com then you need to change the CNAME entries.</p>
<p><strong>3.Server Type</strong> &#8211; <img style="border-top-width: 0px; display: inline; border-left-width: 0px; border-bottom-width: 0px; margin: 0px 15px 10px 0px; border-right-width: 0px" title="server-info" src="http://cdn.techprone.com/wp-content/uploads/2009/02/serverinfo.png" border="0" alt="serverinfo Uncovered things about your web hosting" width="272" height="139" align="left" /> The speed of website directly depends upon the server types.You can compare it with the common computer having different range of RAM’s and Processing powers.</p>
<p>It is quite obvious that the system with higher ram and heavy processing power have more eminent performance than the lower once.So should should know about the your server RAM and processing power as in case your visitors complain about the website performance then <strong>Server Type</strong> may be the accused reason of the guilt.</p>
<p><strong>4.CPU limit-</strong> If you are on the shared hosting then their are 100 no of sites hosted on the same server and commonly if you don’t have the dedicated servers then you your servers have the CPU limits in 18-25%.<strong>What does that means? – </strong>This mean in case you cut off your limit then you will be no doubt sued as a result of “<strong>disabled account</strong>”.Though if you contact the support team then they will re-activate your account with a warning / suggestions “<em>sir please upgrade your account to a dedicated server</em>”.So you should know about <strong>cpu limit</strong> factors as this may suck your website anytime while you are on the bed and you may suffer with a loss in your viewers and product sales.</p>
<p><strong>4.MYSQL database</strong> – This may be of less concern as most of the host provide unlimited no of database but in case you have counted no of databases then you can be hang up in case you have the requirement of testing applications or you want to test open source tools and scripts.</p>
<p>Few common available web hosting services are:</p>
<p>1. Fatcow</p>
<p>2. HostMonster</p>
<p>3. JustHost</p>
<p>4. InMotion</p>
<p>5. HostGator</p>
<p>6. IX Web Hosting</p>
<p>7. BlueHost</p>
<p>8. WebHostingPad</p>
<p>9. LunarPages</p>
<p>10. PowWeb</p>
<p>Note:Best way is to have enough knowledge of <a href="http://www.mybestratedwebhosting.com/best-web-hosting/top-5-ecommerce-web-hosting.html">ecommerce web hosting</a> as any loose steps may leads to arduous loss in money.Last bust not least before buying any hosting your need to have a reviews of web hosting services ,comprehensive Web Hosting Reviews and Comparison their performance,uptime,Cpu factors,Process limits and other described factors so that what ever you will buy is best in the market.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/uncovered-things-about-your-web-hosting/539/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>10 goodies for web developers</title>
		<link>http://www.techprone.com/10-goodies-for-web-developers/475</link>
		<comments>http://www.techprone.com/10-goodies-for-web-developers/475#comments</comments>
		<pubDate>Thu, 05 Feb 2009 16:11:00 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[free]]></category>
		<category><![CDATA[Gadgets]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[productivity]]></category>
		<category><![CDATA[Tips]]></category>
		<category><![CDATA[10 goodies]]></category>
		<category><![CDATA[ajax]]></category>
		<category><![CDATA[ajax forms]]></category>
		<category><![CDATA[CSS based menus]]></category>
		<category><![CDATA[designs]]></category>
		<category><![CDATA[favicon]]></category>
		<category><![CDATA[Form Validation]]></category>
		<category><![CDATA[JavaScipt libraries]]></category>
		<category><![CDATA[jquery]]></category>
		<category><![CDATA[web developments]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=475</guid>
		<description><![CDATA[In order for better performance and usability we often use JavaScipt libraries ,ajax forms , CSS based menus and so many things that provides a good user interface and helps developers to write code in order to develop products more quickly and efficiently. Here is the list for 10 best goodies for the web developers [...]]]></description>
			<content:encoded><![CDATA[<p></p><p>In order for better performance and usability we often use JavaScipt libraries ,ajax forms , CSS based menus and so many things that provides a good user interface and helps developers to write code in order to develop products more quickly and efficiently. <img style="display: block; float: none; margin-left: auto; margin-right: auto; border-width: 0px;" title="10-goodies" src="http://cdn.techprone.com/wp-content/uploads/2009/02/10goodies.jpg" alt="10goodies 10 goodies for web developers" width="542" height="336" border="0" /><br />
<span id="more-475"></span><br />
Here is the list for 10 best goodies for the web developers and designers:</p>
<ol>
<li>
<h4><a href="http://www.ajaxload.info/" rel="nofollow">AJAXload</a></h4>
<p>is a free tool for engendering the little twirling icons that most of the designers use for AJAX request calls. You can choose for 35 different designs, all which customizable colors and the options of transparent backgrounds.</li>
<li>
<h4><a href="http://www.protofunc.com/scripts/jquery/checkbox-radiobutton/" rel="nofollow">Radio Button and Check Box Replacement</a></h4>
<p>This jQuery tool substitutes radio buttons and check boxes with a more invoking presentation.</li>
<li>
<h4><a href="http://tools.dynamicdrive.com/favicon/" rel="nofollow">FavIcon Generator (Dynamic Drive)</a></h4>
<p>This tool provided by the Dynamic Drive and it has one of the best tools out there for creating favicon’s, the little icons for web pages in your browser. You can give it any GIF, JPG, PNG or BMP file and it will covert it into a 16×16 icon file. You can also merge the larger 32×32 and 48×48 into the file as well so that it becomes the perfect desktop icon.Do you know that favicon is quite important decoration of website and development companies like <a href="http://superiorwebsys.com/">toronto web development</a> never forget to put it.Though it takes very less time but you should always keep in mind to embellish your website address bar with a favicon.</li>
<li>
<h4><a href="http://www.willjessup.com/sandbox/jquery/form_validator/form_validate.html" rel="nofollow">Simple jQuery Form Validation</a></h4>
<p>Its it a sort of jQuery form which shows live form-input validators both server-side and browser-side.</li>
<li>
<h4><a href="http://www.stripegenerator.com" rel="nofollow">Stripe Generator</a></h4>
<p>Repeating strips are very Web 2.0 but are very difficult to get right if you draw them from raw. This is where the <a href="http://www.stripegenerator.com" rel="nofollow">stripe generator</a> comes in. You can set lots of different options including thickness, color and orientation to get the perfect stripes for your design.</li>
<li>
<h4><a href="http://plugins.jquery.com/project/pagination" rel="nofollow">Pagination</a></h4>
<p>Create navigational elements: when you have a large number of items, you can group them into pages and present navigational elements that allow users to move from one page to another.</li>
<li>
<h4><a href="http://midmodesign.com/news/coding/jquery-ajax-contact-form-with-honeypot/" rel="nofollow">jQuery AJAX Contact Form</a></h4>
<p>Its a promiscuous way to make a jQuery AJAX contact form with a “honeypot” to foil email bots, load success and error messages dynamically without leaving the page and provide descriptively error logs messages detailing why submitted values have failed validation.</li>
<li>
<h4><a href="http://spritegen.website-performance.org/" rel="nofollow">CSS Sprite Generator</a></h4>
<p>CSS sprites are really fiddly to make, but this excellant website takes out all the hassle. Give them a ZIP file of your icons fiddle about with teh spacing, and it will create the perfect image.<a href="http://alistapart.com/articles/sprites2" rel="nofollow">CSS Sprites2</a> This tutorial demonstrates how to implement inline CSS Sprites2 using jQuery.</li>
<li>
<h4><a href="http://www.patterncooler.com/" rel="nofollow">PatternCooler</a></h4>
<p>With the help of pattern cooler you can easily create background patterns for things like <a href="http://www.twitter.com/dtsn" rel="nofollow">twitter</a> using this simple tool.</li>
<li>
<h4><a href="http://nettuts.com/tutorials/javascript-ajax/use-the-jquery-ui-to-control-the-size-of-your-text/" rel="nofollow">Text Size Slider</a></h4>
<p>This tutorial explains how to use a slider to control the text size of an article on a page. This lets the user control exactly the size that suits them, and is also a pretty impressive feature to have on a site.</li>
</ol>
<p>Their are many more advance technologies used by web developers and companies like toronto web development in their development work for objectively attending a better products.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/10-goodies-for-web-developers/475/feed</wfw:commentRss>
		<slash:comments>5</slash:comments>
		</item>
		<item>
		<title>BearFlix &#8211; fastest video download application on the Web</title>
		<link>http://www.techprone.com/bearflix-fastest-video-download-application-on-the-web/376</link>
		<comments>http://www.techprone.com/bearflix-fastest-video-download-application-on-the-web/376#comments</comments>
		<pubDate>Mon, 15 Dec 2008 01:13:00 +0000</pubDate>
		<dc:creator>Honey Singh</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[how to]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[software]]></category>
		<category><![CDATA[Tools]]></category>
		<category><![CDATA[Video]]></category>
		<category><![CDATA[applications]]></category>
		<category><![CDATA[BearFlix]]></category>
		<category><![CDATA[download]]></category>

		<guid isPermaLink="false">http://www.techprone.com/bearflix-fastest-video-download-application-on-the-web/</guid>
		<description><![CDATA[Do you know that BearFlix boast to say itself the fastest video download application on the Web offering access to unlimited video titles available on the internet and is with a golden tag of “free”.BearFlix is 100% clean, with no adware, no spyware, no viruses, no trojans.Moreover it also have a catchy tag line “Getting [...]]]></description>
			<content:encoded><![CDATA[<p></p><p><a href="http://cdn.techprone.com/wp-content/uploads/2008/12/bearflix.jpg"><img title="bearflix" style="border-right: 0px; border-top: 0px; display: inline; border-left: 0px; border-bottom: 0px" height="383" alt="bearflix thumb BearFlix   fastest video download application on the Web" src="http://cdn.techprone.com/wp-content/uploads/2008/12/bearflix-thumb.jpg" width="518" border="0" /></a> </p>
<p>Do you know that <a href="http://www.bearflix.com/">BearFlix</a> boast to say itself the fastest video download application on the Web offering access to unlimited video titles available on the internet and is with a golden tag of “free”.BearFlix is 100% clean, with no adware, no spyware, no viruses, no trojans.Moreover it also have a catchy tag line “<strong>Getting Videos has Never been Easier</strong>”.</p>
<p><a href="http://cdn.techprone.com/wp-content/uploads/2008/12/bearflix1.jpg"><img title="bearflix1" style="border-right: 0px; border-top: 0px; display: inline; border-left: 0px; border-bottom: 0px" height="194" alt="bearflix1 thumb BearFlix   fastest video download application on the Web" src="http://cdn.techprone.com/wp-content/uploads/2008/12/bearflix1-thumb.jpg" width="549" border="0" /></a> </p>
<p>For your information BearFlix is powered by the same engine as BearShare, but optimized from the ground up for video download. Just pure video downloads. Share BearFlix with your friends. </p>
<p> <span id="more-376"></span>
<p>Few features that commands on the functions of the Bearflix are as follows:</p>
<ul>
<li>It have a awesome reliable free downloads &#8211; automatic resume mechanism</li>
<li>It have a configurable Parental controls</li>
<li>BearFlix is optimized client for fast download of video files</li>
<li>It can easily find more free video files with a &#8216;deep search&#8217; mechanism </li>
<li>It have an improved user interface, designed for Video downloads</li>
<li>Video specific media player </li>
<li>Automatic Virus protection </li>
<li> Easy to use and install in few clicks</li>
<li>It can download videos online for free</li>
<li>It can connect to more sources and download video faster</li>
</ul>
<p><a href="http://www.bearflix.com/downloads.php">Download Now</a></p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/bearflix-fastest-video-download-application-on-the-web/376/feed</wfw:commentRss>
		<slash:comments>9</slash:comments>
		</item>
		<item>
		<title>useful online color tools</title>
		<link>http://www.techprone.com/useful-online-color-tools/359</link>
		<comments>http://www.techprone.com/useful-online-color-tools/359#comments</comments>
		<pubDate>Sun, 30 Nov 2008 21:27:55 +0000</pubDate>
		<dc:creator>harshit</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[google]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[ACT]]></category>
		<category><![CDATA[Adobe]]></category>
		<category><![CDATA[app]]></category>
		<category><![CDATA[axis]]></category>
		<category><![CDATA[Below]]></category>
		<category><![CDATA[blender]]></category>
		<category><![CDATA[color]]></category>
		<category><![CDATA[color combos]]></category>
		<category><![CDATA[color explorer]]></category>
		<category><![CDATA[color hunter]]></category>
		<category><![CDATA[color jack]]></category>
		<category><![CDATA[color palette]]></category>
		<category><![CDATA[color palette generator]]></category>
		<category><![CDATA[color scheme generator]]></category>
		<category><![CDATA[color templates]]></category>
		<category><![CDATA[color trends]]></category>
		<category><![CDATA[color-theory]]></category>
		<category><![CDATA[ColorCombos]]></category>
		<category><![CDATA[ColorExplorer]]></category>
		<category><![CDATA[ColorHunter]]></category>
		<category><![CDATA[ColorMatch]]></category>
		<category><![CDATA[ColorPaletteGenerator]]></category>
		<category><![CDATA[Colors]]></category>
		<category><![CDATA[ColorSchemeGenerator]]></category>
		<category><![CDATA[ColorSynth]]></category>
		<category><![CDATA[colour lovers]]></category>
		<category><![CDATA[COLOURlovers]]></category>
		<category><![CDATA[content]]></category>
		<category><![CDATA[design]]></category>
		<category><![CDATA[design challenge]]></category>
		<category><![CDATA[engine]]></category>
		<category><![CDATA[export]]></category>
		<category><![CDATA[extracts]]></category>
		<category><![CDATA[feature]]></category>
		<category><![CDATA[file]]></category>
		<category><![CDATA[going]]></category>
		<category><![CDATA[goodies]]></category>
		<category><![CDATA[Grab]]></category>
		<category><![CDATA[graphic design project]]></category>
		<category><![CDATA[image]]></category>
		<category><![CDATA[Images]]></category>
		<category><![CDATA[import]]></category>
		<category><![CDATA[input]]></category>
		<category><![CDATA[kuler]]></category>
		<category><![CDATA[learning]]></category>
		<category><![CDATA[lot]]></category>
		<category><![CDATA[mecca]]></category>
		<category><![CDATA[Nice]]></category>
		<category><![CDATA[Office]]></category>
		<category><![CDATA[online]]></category>
		<category><![CDATA[online color tools]]></category>
		<category><![CDATA[online tools]]></category>
		<category><![CDATA[palette]]></category>
		<category><![CDATA[palettes]]></category>
		<category><![CDATA[post]]></category>
		<category><![CDATA[professional designers]]></category>
		<category><![CDATA[redux]]></category>
		<category><![CDATA[requirement]]></category>
		<category><![CDATA[rig]]></category>
		<category><![CDATA[scheme]]></category>
		<category><![CDATA[sessions color calculator]]></category>
		<category><![CDATA[shemer]]></category>
		<category><![CDATA[site]]></category>
		<category><![CDATA[site registration]]></category>
		<category><![CDATA[Slayer]]></category>
		<category><![CDATA[snag]]></category>
		<category><![CDATA[software]]></category>
		<category><![CDATA[sphere]]></category>
		<category><![CDATA[stripe generator]]></category>
		<category><![CDATA[text]]></category>
		<category><![CDATA[time]]></category>
		<category><![CDATA[timewaster]]></category>
		<category><![CDATA[tool]]></category>
		<category><![CDATA[tutorial]]></category>
		<category><![CDATA[use]]></category>
		<category><![CDATA[vote]]></category>
		<category><![CDATA[wall]]></category>
		<category><![CDATA[wall decor]]></category>
		<category><![CDATA[web]]></category>
		<category><![CDATA[Website]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=359</guid>
		<description><![CDATA[It&#8217;s incredible, a lot of online color tools are often better than local free software I&#8217;ve seen. Depending on what you need to do you can be quite sure to find what you need online. Each time I needed I searched and tried some of the online tools and I noticed that it&#8217;s only when [...]]]></description>
			<content:encoded><![CDATA[<p></p><p class="Photo"><span class="photo_container pc_m"><a title="cl" href="http://www.flickr.com/photos/27676525@N08/3071392087/"><img class="pc_img alignright" src="http://farm4.static.flickr.com/3186/3071392087_3a130f9ba8_m.jpg" alt="3071392087 3a130f9ba8 m useful online color tools" width="240" height="200" title="useful online color tools" /></a></span></p>
<p>It&#8217;s incredible, a lot of online color tools are often better than local free software I&#8217;ve seen. Depending on what you need to do you can be quite sure to find what you need online. Each time I needed I searched and tried some of the online tools and I noticed that it&#8217;s only when I&#8217;m really using them that I find out how useful they are.</p>
<p>If you&#8217;re tackling some graphic design project or maybe even your wall decor, getting color hints from ready made color templates from professional designers can be useful. Below are 10 of the better sites to help you out on your design challenge.</p>
<p>These are the ones I found myself using the most:</p>
<ul>
<li><a href="http://www.telecable.es/personales/alberto9/color/index.htm">ColorSynth Axis</a>: This is amazing, it&#8217;s the most advanced color shemer I&#8217;ve seen. It&#8217;s worth going though the tutorial.</li>
<li>Slayer Office&#8217;s <a href="http://slayeroffice.com/tools/color_palette/">color palette blender</a>: This is the one I use most, it&#8217;s simple but amply enough for common use.</li>
<li><a href="http://stylephreak.frogrun.com/cm.php">ColorMatch Redux</a>: Because it can export to .ACT, .AI and text. I use all 3 of them.</li>
</ul>
<p class="Photo"><span class="photo_container pc_m"><a title="colourlovers-__-color-trends--palettes" href="http://www.flickr.com/photos/27676525@N08/3071361547/"><img class="pc_img alignright" src="http://farm4.static.flickr.com/3169/3071361547_63d239fc63_m.jpg" alt="3071361547 63d239fc63 m useful online color tools" width="240" height="94" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://www.colourlovers.com/">COLOURlovers </a></strong> this is pretty close to color mecca. This post should actually be filed as a <a href="http://www.downloadsquad.com/2008/10/08/boombot-time-waster/">Timewaster</a> because you can spend hours checking out the various palettes and patterns and rolling your own. The site is full of features such as create your own palette from a URL you&#8217;re inspired by, join groups devoted to colors (srsly), shore up on the latest color trends, contribute your own content and vote on others.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="color combo" href="http://www.flickr.com/photos/27676525@N08/3071392075/"><img class="pc_img alignright" src="http://farm4.static.flickr.com/3198/3071392075_6c16093fa2_m.jpg" alt="3071392075 6c16093fa2 m useful online color tools" width="240" height="89" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://www.colorcombos.com/">ColorCombos</a></strong> &#8211; nice color palettes to choose from. If there&#8217;s a particular website whose colors you want to snag, check out their &#8220;Grab Website Colors&#8221; engine. You just input the URL of the site you&#8217;re reviewing and ColorCombos extracts the palette for you.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="color explorer" href="http://www.flickr.com/photos/27676525@N08/3071361539/"><img class="pc_img alignleft" src="http://farm4.static.flickr.com/3243/3071361539_4bd52ee2fb_m.jpg" alt="3071361539 4bd52ee2fb m useful online color tools" width="240" height="126" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://colorexplorer.com/default.aspx">ColorExplorer</a></strong> &#8211; another site that&#8217;s feature rich and full of color goodies. Color import from images, palette export to most programs, convert any number of colors into a matching palette, 1 click palette filters and adjustments, plus no requirement for site registration.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="colorjack" href="http://www.flickr.com/photos/27676525@N08/3071361545/"><img class="pc_img alignright" src="http://farm4.static.flickr.com/3013/3071361545_980dee3a86_m.jpg" alt="3071361545 980dee3a86 m useful online color tools" width="240" height="165" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://www.colorjack.com/software/">ColorJack</a></strong> &#8211; very nice color site featuring several apps such as Color Sphere which allows you to choose the right color scheme supporting 18 formulas and 9 color blindness simulations. There&#8217;s also Color Galaxy, an online color visualizer with colors from 27 libraries including everyone&#8217;s favorite forever and ever, Crayola.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="kuler" href="http://www.flickr.com/photos/27676525@N08/3071431241/"><img class="pc_img alignleft" src="http://farm4.static.flickr.com/3176/3071431241_786d7f87ef_m.jpg" alt="3071431241 786d7f87ef m useful online color tools" width="240" height="42" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://kuler.adobe.com/">Kuler</a> </strong>- not surprisingly, Adobe has a fetching web app to help you generate color schemes and if you have Adobe&#8217;s Creative Suite 4, Kuler is built in. Kuler has great tools such as color extractor from an image, theme creation from 1 to several colors, as well as a community you can join and give and receive comments on yours and other&#8217;s creations.</p>
<p class="Photo"><span class="photo_container pc_m"><a title="color scheme generator" href="http://www.flickr.com/photos/27676525@N08/3071361549/"><img class="pc_img alignleft" src="http://farm4.static.flickr.com/3033/3071361549_e022b9b14e_m.jpg" alt="3071361549 e022b9b14e m useful online color tools" width="240" height="118" title="useful online color tools" /></a></span></p>
<p><strong><a href="http://www.wellstyled.com/tools/colorscheme2/index-en.html">Color Scheme Generator</a> </strong>- your basic color tool, nothing fancy. Nice online tool to generate color schemes and palettes to create good-looking and well balanced and harmonic web pages.</p>
<p><strong><a href="http://www.colorhunter.com/">Color Hunter</a> </strong>- allows you to create and find color palettes from photographs.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/useful-online-color-tools/359/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
		<item>
		<title>Online image editor-Pixlr</title>
		<link>http://www.techprone.com/online-image-editor-pixlr/350</link>
		<comments>http://www.techprone.com/online-image-editor-pixlr/350#comments</comments>
		<pubDate>Sun, 09 Nov 2008 21:06:44 +0000</pubDate>
		<dc:creator>harshit</dc:creator>
				<category><![CDATA[Best]]></category>
		<category><![CDATA[internet]]></category>
		<category><![CDATA[software]]></category>
		<category><![CDATA[app]]></category>
		<category><![CDATA[application]]></category>
		<category><![CDATA[bit]]></category>
		<category><![CDATA[editor]]></category>
		<category><![CDATA[fun]]></category>
		<category><![CDATA[image]]></category>
		<category><![CDATA[image editing]]></category>
		<category><![CDATA[Incredibly]]></category>
		<category><![CDATA[Layers]]></category>
		<category><![CDATA[machine]]></category>
		<category><![CDATA[photo editing]]></category>
		<category><![CDATA[photoshop]]></category>
		<category><![CDATA[pixelation]]></category>
		<category><![CDATA[pixlr]]></category>
		<category><![CDATA[range]]></category>
		<category><![CDATA[saturation]]></category>

		<guid isPermaLink="false">http://www.techprone.com/?p=350</guid>
		<description><![CDATA[There are plenty of online image editors out there, but it can be tough to find the right one. If you&#8217;re looking for a few filters, a bit of layer support, and a decent range of tools, Pixlr might be the one you want.While it&#8217;s not the most full-featured image editor you&#8217;ll ever use, Pixlr [...]]]></description>
			<content:encoded><![CDATA[<p></p><p class="Photo"><span class="photo_container pc_m"><a title="pixlr copy1" href="http://www.flickr.com/photos/27676525@N08/3017066308/"><img class="pc_img alignright" src="http://farm4.static.flickr.com/3147/3017066308_18f7e72cf8_m.jpg" alt="3017066308 18f7e72cf8 m Online image editor Pixlr" width="240" height="130" title="Online image editor Pixlr" /></a></span></p>
<p>There are plenty of online image editors out there, but it can be tough to find the right one. If you&#8217;re looking for a few filters, a bit of layer support, and a decent range of tools, <a href="http://www.pixlr.com/">Pixlr might be the one you want.</a>While it&#8217;s not the most full-featured image editor you&#8217;ll ever use, Pixlr makes it fairly easy to do some sophisticated (and unsophisticated) things with images online.You&#8217;ll be familiar with its tools from using desktop apps like Photoshop and The Gimp, but it&#8217;s rare to see so many advances options in a web app.The Flash-based web app has an impressive set of tools, from a text engine that can use nearly any font available on your computer to layers and filters for masking and effects, respectively.Incredibly, there&#8217;s even a multilevel undo! You can import images from your machine or via URL, or paint something up yourself, and either way save it to your desktop. It&#8217;s fun to play around with, though quickly frustrating if you&#8217;re used to more powerful tools.</p>
<p>Some of the Pixlr perks that surprised me: opacity sliders! Layers and transparency! The collection of filters includes halftones, scanlines and pixelation. Common (but useful) features like hue/saturation, resizing, and brightness/contrast are also intact. Next time you find yourself on a computer without Photoshop, you might also find you don&#8217;t need it.The application supports layers, filters and most basic editting tools and when you are ready you can save the image to your desktop as a JPG or PNG.</p>
]]></content:encoded>
			<wfw:commentRss>http://www.techprone.com/online-image-editor-pixlr/350/feed</wfw:commentRss>
		<slash:comments>2</slash:comments>
		</item>
	</channel>
</rss>

<!-- Performance optimized by W3 Total Cache. Learn more: http://www.w3-edge.com/wordpress-plugins/

Minified using disk: basic
Page Caching using disk: enhanced
Content Delivery Network via cdn.techprone.com

Served from: www.techprone.com @ 2012-02-10 11:08:45 -->
